Metagenome / Metatranscriptome Family F012004

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F012004
Family Type	Metagenome / Metatranscriptome
Number of Sequences	284
Average Sequence Length	39 residues
Representative Sequence	MPETVPQNGGYMIAAYIVAGVILLGYALSLYLRARRSLRA
Number of Associated Samples	194
Number of Associated Scaffolds	284

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	85.16 %
% of genes near scaffold ends (potentially truncated)	11.62 %
% of genes from short scaffolds (< 2000 bps)	67.25 %
Associated GOLD sequencing projects	168
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (99.648 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.831 % of family members)
Environment Ontology (ENVO)	Unclassified (38.380 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.831 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 284 Family Scaffolds
PF01578	Cytochrom_C_asm	36.62
PF02602	HEM4	9.51
PF03379	CcmB	6.69
PF01379	Porphobil_deam	3.52
PF00005	ABC_tran	3.17
PF00072	Response_reg	2.11
PF13432	TPR_16	2.11
PF02801	Ketoacyl-synt_C	2.11
PF00490	ALAD	1.76
PF07719	TPR_2	1.41
PF13466	STAS_2	1.06
PF03900	Porphobil_deamC	1.06
PF00230	MIP	0.70
PF00515	TPR_1	0.70
PF16177	ACAS_N	0.70
PF03364	Polyketide_cyc	0.35
PF02922	CBM_48	0.35
PF02080	TrkA_C	0.35
PF00486	Trans_reg_C	0.35
PF01494	FAD_binding_3	0.35
PF00557	Peptidase_M24	0.35
PF00528	BPD_transp_1	0.35
PF01940	DUF92	0.35
PF01613	Flavin_Reduct	0.35
PF13193	AMP-binding_C	0.35
PF13490	zf-HC2	0.35

COG ID	Name	Functional Category	% Frequency in 284 Family Scaffolds
COG1587	Uroporphyrinogen-III synthase	Coenzyme transport and metabolism [H]	9.51
COG2386	ABC-type transport system involved in cytochrome c biogenesis, permease component	Posttranslational modification, protein turnover, chaperones [O]	6.69
COG0181	Porphobilinogen deaminase	Coenzyme transport and metabolism [H]	4.58
COG0113	Delta-aminolevulinic acid dehydratase, porphobilinogen synthase	Coenzyme transport and metabolism [H]	1.76
COG0580	Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)	Carbohydrate transport and metabolism [G]	0.70
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	0.70
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.35
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.35
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.35
COG1836	Cytidylyltransferase family enzyme	General function prediction only [R]	0.35
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	0.35

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	99.65 %
Unclassified	root	N/A	0.35 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	99.65 %
Unclassified	root	N/A	0.35 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	99.65 %
Unclassified	root	N/A	0.35 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	28.17 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.06 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.35 %
Unclassified	root	N/A	0.35 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	28.17 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.06 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.35 %
Unclassified	root	N/A	0.35 %

Name	Rank	Taxonomy	Distribution
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	22.54 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	4.93 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.06 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.35 %
Unclassified	root	N/A	0.35 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	22.54 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	4.93 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.06 %
Pseudonocardiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales	0.35 %
Unclassified	root	N/A	0.35 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	22.54 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	4.93 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.06 %
unclassified Pseudonocardiales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales	0.35 %
Unclassified	root	N/A	0.35 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	22.54 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	2.46 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.06 %
Gemmatimonas	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas	0.70 %
Pseudonocardiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium	0.35 %
Unclassified	root	N/A	0.35 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	22.54 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	2.46 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.06 %
Gemmatimonas aurantiaca	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca	0.70 %
Pseudonocardiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium	0.35 %
Unclassified	root	N/A	0.35 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002557\|JGI25381J37097_1009730	All Organisms → cellular organisms → Bacteria	1701	Open in IMG/M
3300002558\|JGI25385J37094_10002268	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca	6372	Open in IMG/M
3300002560\|JGI25383J37093_10030978	All Organisms → cellular organisms → Bacteria	1790	Open in IMG/M
3300002561\|JGI25384J37096_10101914	All Organisms → cellular organisms → Bacteria	998	Open in IMG/M
3300002561\|JGI25384J37096_10237436	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	532	Open in IMG/M
3300002568\|C688J35102_119297627	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	669	Open in IMG/M
3300002886\|JGI25612J43240_1003639	All Organisms → cellular organisms → Bacteria	2047	Open in IMG/M
3300002907\|JGI25613J43889_10009834	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca	2643	Open in IMG/M
3300002908\|JGI25382J43887_10005201	All Organisms → cellular organisms → Bacteria	6173	Open in IMG/M
3300003319\|soilL2_10012253	All Organisms → cellular organisms → Bacteria	1167	Open in IMG/M
3300003319\|soilL2_10012254	All Organisms → cellular organisms → Bacteria	1427	Open in IMG/M
3300003319\|soilL2_10072476	All Organisms → cellular organisms → Bacteria	4761	Open in IMG/M
3300004062\|Ga0055500_10026620	All Organisms → cellular organisms → Bacteria	1060	Open in IMG/M
3300004114\|Ga0062593_103339136	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	515	Open in IMG/M
3300004463\|Ga0063356_100357538	All Organisms → cellular organisms → Bacteria	1850	Open in IMG/M
3300005166\|Ga0066674_10061750	All Organisms → cellular organisms → Bacteria	1706	Open in IMG/M
3300005166\|Ga0066674_10139621	All Organisms → cellular organisms → Bacteria	1140	Open in IMG/M
3300005167\|Ga0066672_10087803	All Organisms → cellular organisms → Bacteria	1874	Open in IMG/M
3300005171\|Ga0066677_10418126	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300005171\|Ga0066677_10631004	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	605	Open in IMG/M
3300005172\|Ga0066683_10000398	All Organisms → cellular organisms → Bacteria	13438	Open in IMG/M
3300005175\|Ga0066673_10036219	All Organisms → cellular organisms → Bacteria	2408	Open in IMG/M
3300005175\|Ga0066673_10493502	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300005176\|Ga0066679_10015643	All Organisms → cellular organisms → Bacteria	3897	Open in IMG/M
3300005178\|Ga0066688_10957677	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300005180\|Ga0066685_10018989	All Organisms → cellular organisms → Bacteria	4078	Open in IMG/M
3300005184\|Ga0066671_10198381	All Organisms → cellular organisms → Bacteria	1205	Open in IMG/M
3300005186\|Ga0066676_10102708	All Organisms → cellular organisms → Bacteria	1737	Open in IMG/M
3300005336\|Ga0070680_100010997	All Organisms → cellular organisms → Bacteria	6995	Open in IMG/M
3300005341\|Ga0070691_10577156	All Organisms → cellular organisms → Bacteria	661	Open in IMG/M
3300005440\|Ga0070705_100249784	All Organisms → cellular organisms → Bacteria	1244	Open in IMG/M
3300005440\|Ga0070705_101117605	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300005444\|Ga0070694_100003891	All Organisms → cellular organisms → Bacteria	8924	Open in IMG/M
3300005444\|Ga0070694_100329426	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1177	Open in IMG/M
3300005445\|Ga0070708_100088869	All Organisms → cellular organisms → Bacteria	2810	Open in IMG/M
3300005445\|Ga0070708_100667946	All Organisms → cellular organisms → Bacteria	979	Open in IMG/M
3300005446\|Ga0066686_10015181	All Organisms → cellular organisms → Bacteria	4154	Open in IMG/M
3300005450\|Ga0066682_10141590	All Organisms → cellular organisms → Bacteria	1528	Open in IMG/M
3300005451\|Ga0066681_10553021	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300005454\|Ga0066687_10059745	All Organisms → cellular organisms → Bacteria	1809	Open in IMG/M
3300005526\|Ga0073909_10140851	All Organisms → cellular organisms → Bacteria	996	Open in IMG/M
3300005526\|Ga0073909_10600235	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300005536\|Ga0070697_100348291	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1279	Open in IMG/M
3300005537\|Ga0070730_10001187	All Organisms → cellular organisms → Bacteria	25613	Open in IMG/M
3300005549\|Ga0070704_100087430	All Organisms → cellular organisms → Bacteria	2313	Open in IMG/M
3300005552\|Ga0066701_10671336	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	625	Open in IMG/M
3300005553\|Ga0066695_10032586	All Organisms → cellular organisms → Bacteria	3022	Open in IMG/M
3300005553\|Ga0066695_10048099	All Organisms → cellular organisms → Bacteria	2527	Open in IMG/M
3300005553\|Ga0066695_10664182	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	616	Open in IMG/M
3300005554\|Ga0066661_10058986	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2215	Open in IMG/M
3300005555\|Ga0066692_10054693	All Organisms → cellular organisms → Bacteria	2232	Open in IMG/M
3300005556\|Ga0066707_10002029	All Organisms → cellular organisms → Bacteria	8036	Open in IMG/M
3300005556\|Ga0066707_10002742	All Organisms → cellular organisms → Bacteria	7236	Open in IMG/M
3300005556\|Ga0066707_10016424	All Organisms → cellular organisms → Bacteria	3820	Open in IMG/M
3300005558\|Ga0066698_10146628	All Organisms → cellular organisms → Bacteria	1591	Open in IMG/M
3300005559\|Ga0066700_10455750	All Organisms → cellular organisms → Bacteria	897	Open in IMG/M
3300005561\|Ga0066699_10210899	All Organisms → cellular organisms → Bacteria	1356	Open in IMG/M
3300005566\|Ga0066693_10479716	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	512	Open in IMG/M
3300005569\|Ga0066705_10084226	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1862	Open in IMG/M
3300005569\|Ga0066705_10332259	All Organisms → cellular organisms → Bacteria	961	Open in IMG/M
3300005569\|Ga0066705_10345779	All Organisms → cellular organisms → Bacteria	938	Open in IMG/M
3300005574\|Ga0066694_10343248	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	708	Open in IMG/M
3300005575\|Ga0066702_10361821	All Organisms → cellular organisms → Bacteria	882	Open in IMG/M
3300005576\|Ga0066708_10156748	All Organisms → cellular organisms → Bacteria	1403	Open in IMG/M
3300005576\|Ga0066708_10255525	All Organisms → cellular organisms → Bacteria	1115	Open in IMG/M
3300005586\|Ga0066691_10173579	All Organisms → cellular organisms → Bacteria	1247	Open in IMG/M
3300005598\|Ga0066706_11520112	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	504	Open in IMG/M
3300005713\|Ga0066905_100004455	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	5738	Open in IMG/M
3300005713\|Ga0066905_101015755	All Organisms → cellular organisms → Bacteria	732	Open in IMG/M
3300005842\|Ga0068858_101790081	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300005876\|Ga0075300_1047595	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300006031\|Ga0066651_10012778	All Organisms → cellular organisms → Bacteria	3451	Open in IMG/M
3300006031\|Ga0066651_10447625	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300006034\|Ga0066656_10021894	All Organisms → cellular organisms → Bacteria	3435	Open in IMG/M
3300006046\|Ga0066652_100223003	All Organisms → cellular organisms → Bacteria	1635	Open in IMG/M
3300006046\|Ga0066652_100451573	All Organisms → cellular organisms → Bacteria	1183	Open in IMG/M
3300006794\|Ga0066658_10309706	All Organisms → cellular organisms → Bacteria	843	Open in IMG/M
3300006796\|Ga0066665_11178024	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	584	Open in IMG/M
3300006797\|Ga0066659_10054402	All Organisms → cellular organisms → Bacteria	2543	Open in IMG/M
3300006844\|Ga0075428_100001087	All Organisms → cellular organisms → Bacteria	28949	Open in IMG/M
3300006844\|Ga0075428_100089585	All Organisms → cellular organisms → Bacteria	3356	Open in IMG/M
3300006845\|Ga0075421_100054738	All Organisms → cellular organisms → Bacteria → Proteobacteria	5046	Open in IMG/M
3300006845\|Ga0075421_100274840	All Organisms → cellular organisms → Bacteria	2057	Open in IMG/M
3300006845\|Ga0075421_100519302	All Organisms → cellular organisms → Bacteria	1412	Open in IMG/M
3300006846\|Ga0075430_100883650	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300006852\|Ga0075433_10036325	All Organisms → cellular organisms → Bacteria	4243	Open in IMG/M
3300006852\|Ga0075433_10053470	All Organisms → cellular organisms → Bacteria	3521	Open in IMG/M
3300006852\|Ga0075433_10170730	All Organisms → cellular organisms → Bacteria	1935	Open in IMG/M
3300006852\|Ga0075433_11945173	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	504	Open in IMG/M
3300006854\|Ga0075425_100012128	All Organisms → cellular organisms → Bacteria	9226	Open in IMG/M
3300006854\|Ga0075425_100367134	All Organisms → cellular organisms → Bacteria	1657	Open in IMG/M
3300006854\|Ga0075425_102782885	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	538	Open in IMG/M
3300006865\|Ga0073934_10103199	All Organisms → cellular organisms → Bacteria	2164	Open in IMG/M
3300006871\|Ga0075434_100763775	All Organisms → cellular organisms → Bacteria	983	Open in IMG/M
3300006914\|Ga0075436_100371483	All Organisms → cellular organisms → Bacteria	1033	Open in IMG/M
3300006918\|Ga0079216_10151779	All Organisms → cellular organisms → Bacteria	1207	Open in IMG/M
3300007255\|Ga0099791_10021282	All Organisms → cellular organisms → Bacteria	2790	Open in IMG/M
3300007265\|Ga0099794_10028155	All Organisms → cellular organisms → Bacteria	2612	Open in IMG/M
3300009012\|Ga0066710_100027074	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	6561	Open in IMG/M
3300009012\|Ga0066710_100317917	All Organisms → cellular organisms → Bacteria	2288	Open in IMG/M
3300009089\|Ga0099828_10003737	All Organisms → cellular organisms → Bacteria	10664	Open in IMG/M
3300009090\|Ga0099827_10009751	All Organisms → cellular organisms → Bacteria	6120	Open in IMG/M
3300009090\|Ga0099827_11503152	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300009094\|Ga0111539_10330195	All Organisms → cellular organisms → Bacteria	1775	Open in IMG/M
3300009156\|Ga0111538_10060491	All Organisms → cellular organisms → Bacteria	4833	Open in IMG/M
3300009156\|Ga0111538_11678454	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300009597\|Ga0105259_1043569	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	989	Open in IMG/M
3300009678\|Ga0105252_10003372	All Organisms → cellular organisms → Bacteria	6172	Open in IMG/M
3300009804\|Ga0105063_1012696	All Organisms → cellular organisms → Bacteria	918	Open in IMG/M
3300010043\|Ga0126380_11634698	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	576	Open in IMG/M
3300010047\|Ga0126382_12048149	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	546	Open in IMG/M
3300010159\|Ga0099796_10516882	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	535	Open in IMG/M
3300010301\|Ga0134070_10184448	All Organisms → cellular organisms → Bacteria	760	Open in IMG/M
3300010320\|Ga0134109_10013519	All Organisms → cellular organisms → Bacteria	2400	Open in IMG/M
3300010320\|Ga0134109_10220857	All Organisms → cellular organisms → Bacteria	706	Open in IMG/M
3300010325\|Ga0134064_10086124	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1015	Open in IMG/M
3300011443\|Ga0137457_1052401	All Organisms → cellular organisms → Bacteria	1199	Open in IMG/M
3300012096\|Ga0137389_10270124	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1433	Open in IMG/M
3300012096\|Ga0137389_10626353	All Organisms → cellular organisms → Bacteria	924	Open in IMG/M
3300012198\|Ga0137364_10632394	All Organisms → cellular organisms → Bacteria	807	Open in IMG/M
3300012199\|Ga0137383_10135891	All Organisms → cellular organisms → Bacteria	1797	Open in IMG/M
3300012199\|Ga0137383_10693347	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300012199\|Ga0137383_11022624	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	601	Open in IMG/M
3300012200\|Ga0137382_10023646	All Organisms → cellular organisms → Bacteria	3571	Open in IMG/M
3300012200\|Ga0137382_10118414	All Organisms → cellular organisms → Bacteria	1767	Open in IMG/M
3300012200\|Ga0137382_10622626	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300012201\|Ga0137365_10151806	All Organisms → cellular organisms → Bacteria	1739	Open in IMG/M
3300012202\|Ga0137363_10194999	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1621	Open in IMG/M
3300012203\|Ga0137399_10145859	All Organisms → cellular organisms → Bacteria	1885	Open in IMG/M
3300012203\|Ga0137399_10572872	All Organisms → cellular organisms → Bacteria	949	Open in IMG/M
3300012203\|Ga0137399_10995053	All Organisms → cellular organisms → Bacteria	706	Open in IMG/M
3300012204\|Ga0137374_10902830	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300012206\|Ga0137380_10156764	All Organisms → cellular organisms → Bacteria	2076	Open in IMG/M
3300012208\|Ga0137376_10874046	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300012208\|Ga0137376_10995509	All Organisms → cellular organisms → Bacteria	718	Open in IMG/M
3300012208\|Ga0137376_11125071	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	671	Open in IMG/M
3300012211\|Ga0137377_11912843	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	510	Open in IMG/M
3300012285\|Ga0137370_10004597	All Organisms → cellular organisms → Bacteria	6180	Open in IMG/M
3300012351\|Ga0137386_10858409	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300012358\|Ga0137368_10032337	All Organisms → cellular organisms → Bacteria	4712	Open in IMG/M
3300012360\|Ga0137375_10121291	All Organisms → cellular organisms → Bacteria	2611	Open in IMG/M
3300012361\|Ga0137360_10416087	All Organisms → cellular organisms → Bacteria	1135	Open in IMG/M
3300012362\|Ga0137361_10481477	All Organisms → cellular organisms → Bacteria	1140	Open in IMG/M
3300012685\|Ga0137397_10017928	All Organisms → cellular organisms → Bacteria	4950	Open in IMG/M
3300012917\|Ga0137395_10692635	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300012918\|Ga0137396_10220750	All Organisms → cellular organisms → Bacteria	1396	Open in IMG/M
3300012923\|Ga0137359_11029226	All Organisms → cellular organisms → Bacteria	706	Open in IMG/M
3300012924\|Ga0137413_11224514	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	599	Open in IMG/M
3300012944\|Ga0137410_10735476	All Organisms → cellular organisms → Bacteria	824	Open in IMG/M
3300012976\|Ga0134076_10169431	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300012976\|Ga0134076_10341857	All Organisms → cellular organisms → Bacteria	656	Open in IMG/M
3300014157\|Ga0134078_10034163	All Organisms → cellular organisms → Bacteria	1688	Open in IMG/M
3300015054\|Ga0137420_1268189	All Organisms → cellular organisms → Bacteria	739	Open in IMG/M
3300015245\|Ga0137409_10311514	All Organisms → cellular organisms → Bacteria	1381	Open in IMG/M
3300015254\|Ga0180089_1042593	All Organisms → cellular organisms → Bacteria	882	Open in IMG/M
3300015357\|Ga0134072_10321293	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300017656\|Ga0134112_10015318	All Organisms → cellular organisms → Bacteria	2585	Open in IMG/M
3300017656\|Ga0134112_10251586	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	701	Open in IMG/M
3300017656\|Ga0134112_10266632	All Organisms → cellular organisms → Bacteria	682	Open in IMG/M
3300017659\|Ga0134083_10334186	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	649	Open in IMG/M
3300017997\|Ga0184610_1012694	All Organisms → cellular organisms → Bacteria	2147	Open in IMG/M
3300017997\|Ga0184610_1027442	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1575	Open in IMG/M
3300018028\|Ga0184608_10045201	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1715	Open in IMG/M
3300018054\|Ga0184621_10018160	All Organisms → cellular organisms → Bacteria	2128	Open in IMG/M
3300018056\|Ga0184623_10059008	All Organisms → cellular organisms → Bacteria	1759	Open in IMG/M
3300018071\|Ga0184618_10063831	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1371	Open in IMG/M
3300018076\|Ga0184609_10014772	All Organisms → cellular organisms → Bacteria	2993	Open in IMG/M
3300018084\|Ga0184629_10070966	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1645	Open in IMG/M
3300018084\|Ga0184629_10492266	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	639	Open in IMG/M
3300018431\|Ga0066655_10034696	All Organisms → cellular organisms → Bacteria	2490	Open in IMG/M
3300018433\|Ga0066667_10018071	All Organisms → cellular organisms → Bacteria → Proteobacteria	3662	Open in IMG/M
3300018433\|Ga0066667_11191573	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300018433\|Ga0066667_11774151	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	557	Open in IMG/M
3300018433\|Ga0066667_11774993	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	557	Open in IMG/M
3300018468\|Ga0066662_10050319	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	2650	Open in IMG/M
3300018468\|Ga0066662_10111403	All Organisms → cellular organisms → Bacteria	1970	Open in IMG/M
3300018482\|Ga0066669_10041726	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	2821	Open in IMG/M
3300018482\|Ga0066669_10074120	All Organisms → cellular organisms → Bacteria	2263	Open in IMG/M
3300018482\|Ga0066669_10079459	All Organisms → cellular organisms → Bacteria	2202	Open in IMG/M
3300018482\|Ga0066669_10135902	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1781	Open in IMG/M
3300018482\|Ga0066669_10207175	All Organisms → cellular organisms → Bacteria	1508	Open in IMG/M
3300018482\|Ga0066669_10233741	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1439	Open in IMG/M
3300018482\|Ga0066669_10448212	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1107	Open in IMG/M
3300018482\|Ga0066669_11038144	All Organisms → cellular organisms → Bacteria	740	Open in IMG/M
3300018482\|Ga0066669_11555741	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	602	Open in IMG/M
3300019360\|Ga0187894_10523719	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300019877\|Ga0193722_1003498	All Organisms → cellular organisms → Bacteria	3843	Open in IMG/M
3300019879\|Ga0193723_1000275	All Organisms → cellular organisms → Bacteria	19621	Open in IMG/M
3300019879\|Ga0193723_1000513	All Organisms → cellular organisms → Bacteria	15294	Open in IMG/M
3300019883\|Ga0193725_1056571	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	991	Open in IMG/M
3300020022\|Ga0193733_1174631	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	567	Open in IMG/M
3300021081\|Ga0210379_10391793	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300021086\|Ga0179596_10171793	All Organisms → cellular organisms → Bacteria	1043	Open in IMG/M
3300021344\|Ga0193719_10153449	All Organisms → cellular organisms → Bacteria	993	Open in IMG/M
3300021418\|Ga0193695_1028164	All Organisms → cellular organisms → Bacteria	1198	Open in IMG/M
3300024330\|Ga0137417_1070594	All Organisms → cellular organisms → Bacteria	806	Open in IMG/M
3300025325\|Ga0209341_10266516	All Organisms → cellular organisms → Bacteria	1417	Open in IMG/M
3300025885\|Ga0207653_10000060	All Organisms → cellular organisms → Bacteria	84774	Open in IMG/M
3300025885\|Ga0207653_10098359	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1032	Open in IMG/M
3300025910\|Ga0207684_10259360	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1500	Open in IMG/M
3300025910\|Ga0207684_10917350	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	736	Open in IMG/M
3300025912\|Ga0207707_11259043	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300025917\|Ga0207660_10205708	All Organisms → cellular organisms → Bacteria	1539	Open in IMG/M
3300025917\|Ga0207660_10259671	All Organisms → cellular organisms → Bacteria	1373	Open in IMG/M
3300025917\|Ga0207660_11698324	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300025918\|Ga0207662_10109980	All Organisms → cellular organisms → Bacteria	1717	Open in IMG/M
3300025942\|Ga0207689_10844706	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	773	Open in IMG/M
3300025965\|Ga0210090_1063405	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	501	Open in IMG/M
3300025988\|Ga0208141_1014102	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300026285\|Ga0209438_1000769	All Organisms → cellular organisms → Bacteria	10176	Open in IMG/M
3300026285\|Ga0209438_1121918	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	727	Open in IMG/M
3300026295\|Ga0209234_1017361	All Organisms → cellular organisms → Bacteria	2725	Open in IMG/M
3300026296\|Ga0209235_1000338	All Organisms → cellular organisms → Bacteria	23022	Open in IMG/M
3300026296\|Ga0209235_1009313	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	5457	Open in IMG/M
3300026296\|Ga0209235_1226299	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	599	Open in IMG/M
3300026296\|Ga0209235_1256046	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	540	Open in IMG/M
3300026300\|Ga0209027_1044096	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1678	Open in IMG/M
3300026305\|Ga0209688_1094310	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300026312\|Ga0209153_1037362	All Organisms → cellular organisms → Bacteria	1684	Open in IMG/M
3300026324\|Ga0209470_1018900	All Organisms → cellular organisms → Bacteria	3781	Open in IMG/M
3300026324\|Ga0209470_1159377	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	987	Open in IMG/M
3300026327\|Ga0209266_1002522	All Organisms → cellular organisms → Bacteria	11466	Open in IMG/M
3300026327\|Ga0209266_1087974	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1392	Open in IMG/M
3300026335\|Ga0209804_1247122	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	674	Open in IMG/M
3300026528\|Ga0209378_1009501	All Organisms → cellular organisms → Bacteria	5971	Open in IMG/M
3300026528\|Ga0209378_1013683	All Organisms → cellular organisms → Bacteria	4769	Open in IMG/M
3300026528\|Ga0209378_1256960	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	555	Open in IMG/M
3300026530\|Ga0209807_1020890	All Organisms → cellular organisms → Bacteria	3188	Open in IMG/M
3300026530\|Ga0209807_1122456	All Organisms → cellular organisms → Bacteria	1059	Open in IMG/M
3300026530\|Ga0209807_1162668	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300026536\|Ga0209058_1003493	All Organisms → cellular organisms → Bacteria	12691	Open in IMG/M
3300026537\|Ga0209157_1022095	All Organisms → cellular organisms → Bacteria	3882	Open in IMG/M
3300026538\|Ga0209056_10008537	All Organisms → cellular organisms → Bacteria	10497	Open in IMG/M
3300026538\|Ga0209056_10037144	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	4517	Open in IMG/M
3300026540\|Ga0209376_1202499	All Organisms → cellular organisms → Bacteria	901	Open in IMG/M
3300026548\|Ga0209161_10575462	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	504	Open in IMG/M
3300027573\|Ga0208454_1001021	All Organisms → cellular organisms → Bacteria	12697	Open in IMG/M
3300027573\|Ga0208454_1015335	All Organisms → cellular organisms → Bacteria	1862	Open in IMG/M
3300027643\|Ga0209076_1109913	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	780	Open in IMG/M
3300027655\|Ga0209388_1078083	All Organisms → cellular organisms → Bacteria	954	Open in IMG/M
3300027671\|Ga0209588_1000470	All Organisms → cellular organisms → Bacteria	10352	Open in IMG/M
3300027691\|Ga0209485_1105961	All Organisms → cellular organisms → Bacteria	798	Open in IMG/M
3300027738\|Ga0208989_10245405	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	584	Open in IMG/M
3300027857\|Ga0209166_10005249	All Organisms → cellular organisms → Bacteria	8866	Open in IMG/M
3300027875\|Ga0209283_10005070	All Organisms → cellular organisms → Bacteria	7548	Open in IMG/M
3300027882\|Ga0209590_10001297	All Organisms → cellular organisms → Bacteria	9372	Open in IMG/M
3300027882\|Ga0209590_10046593	All Organisms → cellular organisms → Bacteria	2391	Open in IMG/M
3300027882\|Ga0209590_10290024	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1049	Open in IMG/M
3300027903\|Ga0209488_10044274	All Organisms → cellular organisms → Bacteria	3269	Open in IMG/M
3300027909\|Ga0209382_10099752	All Organisms → cellular organisms → Bacteria	3404	Open in IMG/M
3300027909\|Ga0209382_10128371	All Organisms → cellular organisms → Bacteria	2952	Open in IMG/M
3300027909\|Ga0209382_10414522	All Organisms → cellular organisms → Bacteria	1498	Open in IMG/M
3300027909\|Ga0209382_10880804	All Organisms → cellular organisms → Bacteria	945	Open in IMG/M
3300028145\|Ga0247663_1080769	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	578	Open in IMG/M
3300028536\|Ga0137415_10028764	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	5475	Open in IMG/M
3300028536\|Ga0137415_10208422	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium	1772	Open in IMG/M
3300028536\|Ga0137415_10376007	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1224	Open in IMG/M
3300028718\|Ga0307307_10137312	All Organisms → cellular organisms → Bacteria	759	Open in IMG/M
3300028819\|Ga0307296_10440535	All Organisms → cellular organisms → Bacteria	712	Open in IMG/M
3300028884\|Ga0307308_10095030	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1418	Open in IMG/M
3300028884\|Ga0307308_10232112	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300030997\|Ga0073997_10719414	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300031170\|Ga0307498_10051559	All Organisms → cellular organisms → Bacteria	1116	Open in IMG/M
3300031199\|Ga0307495_10166814	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	582	Open in IMG/M
3300031455\|Ga0307505_10016897	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	3449	Open in IMG/M
3300031716\|Ga0310813_10005383	All Organisms → cellular organisms → Bacteria	7911	Open in IMG/M
3300031720\|Ga0307469_10012544	All Organisms → cellular organisms → Bacteria → Proteobacteria	4247	Open in IMG/M
3300031720\|Ga0307469_11214206	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	713	Open in IMG/M
3300031740\|Ga0307468_100968182	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	745	Open in IMG/M
3300031820\|Ga0307473_10389196	All Organisms → cellular organisms → Bacteria	910	Open in IMG/M
3300031820\|Ga0307473_10852335	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	654	Open in IMG/M
3300031820\|Ga0307473_11267258	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	550	Open in IMG/M
3300031965\|Ga0326597_10129778	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	3034	Open in IMG/M
3300031965\|Ga0326597_10401081	All Organisms → cellular organisms → Bacteria	1524	Open in IMG/M
3300032180\|Ga0307471_101482273	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300032180\|Ga0307471_101712004	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	782	Open in IMG/M
3300032180\|Ga0307471_101911845	All Organisms → cellular organisms → Bacteria	742	Open in IMG/M
3300032180\|Ga0307471_103303138	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300032205\|Ga0307472_100893517	All Organisms → cellular organisms → Bacteria	822	Open in IMG/M
3300032770\|Ga0335085_10022001	All Organisms → cellular organisms → Bacteria	9071	Open in IMG/M
3300033407\|Ga0214472_10014215	All Organisms → cellular organisms → Bacteria	8272	Open in IMG/M
3300033813\|Ga0364928_0009579	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1773	Open in IMG/M
3300034178\|Ga0364934_0070339	All Organisms → cellular organisms → Bacteria	1302	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.20%
Host-Associated	Host-Associated	8.80%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	84.51%
Plants	Host-Associated → Plants	8.80%
Aquatic	Environmental → Aquatic	6.69%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	83.45%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.75%
Sediment	Environmental → Aquatic → Sediment	5.28%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.06%
Marine	Environmental → Aquatic → Marine	0.70%
Floodplain	Environmental → Terrestrial → Floodplain	0.70%
Freshwater	Environmental → Aquatic → Freshwater	0.35%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.35%
Cave	Environmental → Terrestrial → Cave	0.35%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	72.18%
Loam	Environmental → Terrestrial → Soil → Loam	9.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.75%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.28%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.06%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.06%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.70%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.70%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.35%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	0.35%
Sand	Environmental → Terrestrial → Soil → Sand	0.35%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.35%

Habitat	Taxonomy	Distribution
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	33.80%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	31.34%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.75%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.28%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.58%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.11%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.76%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.06%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.06%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.06%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.70%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.70%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.35%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	0.35%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.35%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.35%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.35%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.35%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	21.83%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	19.01%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	11.97%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.99%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.58%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	4.23%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.87%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.17%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.11%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.76%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.76%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.41%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	1.06%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.70%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.70%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.70%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.70%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.70%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.70%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.35%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	0.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.35%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.35%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.35%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.35%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.35%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.35%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.35%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.35%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.35%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm	Environmental	Open in IMG/M
3300002558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm	Environmental	Open in IMG/M
3300002560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm	Environmental	Open in IMG/M
3300002561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300002886	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm	Environmental	Open in IMG/M
3300002907	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm	Environmental	Open in IMG/M
3300002908	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300004062	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005876	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009597	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009804	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300011443	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015254	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D	Environmental	Open in IMG/M
3300015357	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300019877	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300019883	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2	Environmental	Open in IMG/M
3300020022	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300021418	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2	Environmental	Open in IMG/M
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025325	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025965	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025988	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes)	Environmental	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026296	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026305	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)	Environmental	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026327	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)	Environmental	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300026537	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027573	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)	Environmental	Open in IMG/M
3300027643	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)	Environmental	Open in IMG/M
3300027655	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)	Environmental	Open in IMG/M
3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)	Environmental	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027738	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)	Environmental	Open in IMG/M
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028145	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028718	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300030997	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031199	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S	Environmental	Open in IMG/M
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033407	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175	Environmental	Open in IMG/M
3300033813	Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17	Environmental	Open in IMG/M
3300034178	Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25381J37097_10097302	3300002557	Grasslands Soil	MPEAVPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP*
JGI25385J37094_100022683	3300002558	Grasslands Soil	MLEQVPQNGGYMIAAYSVAAGILIGYAVSLYLRARRSLRA*
JGI25383J37093_100309782	3300002560	Grasslands Soil	MPETIPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA*
JGI25384J37096_101019142	3300002561	Grasslands Soil	MPETVPQNGGYLVAAYIVVAVILIGYALSLYLRARRSLRA*
JGI25384J37096_102374362	3300002561	Grasslands Soil	RSDMPETVPQNGGYLVAAYIVVAVILIGYALSLYLRARRSLRA*
C688J35102_1192976272	3300002568	Soil	MEAWVMPEVPPQNAGYMIAAYIIVAALVAGYALSLYLRARRSLRA*
JGI25612J43240_10036394	3300002886	Grasslands Soil	MPETVPQNGGYMVAAYIIVAVITVGYTLSLYLRARRSFRA*
JGI25613J43889_100098345	3300002907	Grasslands Soil	MPETVPQNGGYMVAAYIIVAVIILGYALSLYLRTRRSFRA*
JGI25382J43887_100052013	3300002908	Grasslands Soil	MPETVPQNGNYMIAAYILVGVILVGYAVSLYLRARRSLRP*
soilL2_100122532	3300003319	Sugarcane Root And Bulk Soil	MPETVPQNAGYMIAAYVITGTILIGYAVSLYLRARRALRP*
soilL2_100122542	3300003319	Sugarcane Root And Bulk Soil	MPESIPQNAGYMIAAYIVTGTILVSYAVSLYLRARRALRP*
soilL2_100724766	3300003319	Sugarcane Root And Bulk Soil	MPETVPQNAGYMIAAYIVTGTIMVAYAVSLYLRARRALRP*
Ga0055500_100266202	3300004062	Natural And Restored Wetlands	MQSVPQNAGYMIAAYILTGAILLGYTLSLYLRARRSLRS*
Ga0062593_1033391361	3300004114	Soil	MQTVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP*
Ga0063356_1003575382	3300004463	Arabidopsis Thaliana Rhizosphere	MQTVPENAGYMIAAYIITGTILIGYAVSLYLRARRALRP*
Ga0066674_100617503	3300005166	Soil	MPETIPQNGSFMIAAYIVAAVILIGYSLSLYLRARRSLRA*
Ga0066674_101396213	3300005166	Soil	MPQSIPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA*
Ga0066672_100878034	3300005167	Soil	MPETVPQNGGYMIAAYIVAGAILVSYALSLYLRARRSLRP*
Ga0066677_104181262	3300005171	Soil	MPQTPAPPQNGDYMIAAYCIVGAIFILYTLSLYLRARRSLRP*
Ga0066677_106310042	3300005171	Soil	MPDTVPQNGSYMIAAYILVGVILAGYALLLYLRARRSLRP*
Ga0066683_1000039811	3300005172	Soil	MPDTVPQNGGYMVGAYVVAAVILISYALSLYLRTRRSLRA*
Ga0066673_100362195	3300005175	Soil	MPETVPQNGGYMVAAYVVAAVILISYAVSLYLRTRRTLRP*
Ga0066673_104935022	3300005175	Soil	MPETVPQNGSYMIAAYILVGVILAGYALLLYLRARRSLRP*
Ga0066679_100156433	3300005176	Soil	MLEQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA*
Ga0066688_109576772	3300005178	Soil	MPDTVPQNGGYMVAAYVVAAVILISYAVSLYLRTRRSLRP*
Ga0066685_100189893	3300005180	Soil	MPETIPQNGSFMLAAYIVAAVILIGYSLSLYLRARRSLRA*
Ga0066671_101983813	3300005184	Soil	MPQTPAPPQNGGYMIAAYCIVGAIFILYTLSLYLRARRSLRP*
Ga0066676_101027082	3300005186	Soil	MRDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA*
Ga0070680_10001099711	3300005336	Corn Rhizosphere	MQAPVPQNGGYMIAAYIVTGVIVVGYAVSLYLRARRALRP*
Ga0070691_105771562	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MPETVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRALRP*
Ga0070705_1002497842	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MPETVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP*
Ga0070705_1011176052	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MPEAVPQNAGYMIAAYIIVAVILGGYALSLYLRTRRSLRA*
Ga0070694_10000389112	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MPQAAPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA*
Ga0070694_1003294262	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MQPVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRALRP*
Ga0070708_1000888694	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MLEQVPQNGGYLVAAYIVAAGILIGYAVSLYLRARRSLRA*
Ga0070708_1006679463	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MPETVPQNGGYMVAAYIVAAVIVISYAVSLYLRTRRSLRP*
Ga0066686_100151815	3300005446	Soil	MPETIPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA*
Ga0066682_101415903	3300005450	Soil	MHDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA*
Ga0066681_105530212	3300005451	Soil	MPQTPAPPQNGGYMIAAYCIVGAIFIVYTLSLYLRARRSLRP*
Ga0066687_100597453	3300005454	Soil	MPETVPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP*
Ga0073909_101408512	3300005526	Surface Soil	MPETVPQNAGYMIAAYIIVAVIVGGYALSLYLRARRSLRP*
Ga0073909_106002352	3300005526	Surface Soil	MPETVPQNASYMIAAYIIAGTILVGYAVSLYLRARRAL
Ga0070697_1003482912	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MPEAVPQNAGYMIAAYIIVAVILGGYALSLYLHTRRSLRA*
Ga0070730_1000118730	3300005537	Surface Soil	MLSDTPQNGGYMIAAYVVAAVILLGYTLSLYLRARRSLRP*
Ga0070704_1000874302	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MPETVPQNAGYMIAAYVITGAILFGYALSLYLRARRSLRP*
Ga0066701_106713362	3300005552	Soil	MHETVPQNGGYMIAAYIVVAPILIGYALSLYLRARRSLRA*
Ga0066695_100325864	3300005553	Soil	MPENGTYMIAAYILVGVILVGYALSLYLRTRRSLRP*
Ga0066695_100480994	3300005553	Soil	MQDVPQNGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP*
Ga0066695_106641822	3300005553	Soil	MPENGNYMIAAYILVGVILSGYALSLYLRARRSLRP*
Ga0066661_100589862	3300005554	Soil	MPETVPQNGGYMVAAYVVAAVILLSYAVSLYLRTRRTLRP*
Ga0066692_100546932	3300005555	Soil	MPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRP*
Ga0066707_100020297	3300005556	Soil	MPQSIPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA*
Ga0066707_100027427	3300005556	Soil	MHETVPQNGGYMIAAYIVVAAILIGYALSLYLRARRSLRA*
Ga0066707_100164242	3300005556	Soil	MPESVPQNGGYMIAAYIVAGAILVSYALSLYLRARRSLRP*
Ga0066698_101466283	3300005558	Soil	MPENGNYMIAAYILVGVILAGYALSLYLRARRSLRP*
Ga0066700_104557502	3300005559	Soil	MPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRA*
Ga0066699_102108993	3300005561	Soil	MPETLPQNGSYMIAAYILVGVILGGYALLLYLRARRSLRP*
Ga0066693_104797162	3300005566	Soil	MPETVPQNGSYMIAAYILVGLILGGYALLLYLRARRSLRP*
Ga0066705_100842264	3300005569	Soil	MPETVPQNGGYMVAAYVVAAVILLSYAVSLYLRTRR
Ga0066705_103322592	3300005569	Soil	MLEQVPQNGGYMVAAYIVAAGILIGYAVSLYLRARRSLRA*
Ga0066705_103457793	3300005569	Soil	MPETFPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP*
Ga0066694_103432481	3300005574	Soil	NNWRLWEERSAMHDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA*
Ga0066702_103618212	3300005575	Soil	MPETVPQNGGYMIAAYIVAAVILISYAVSLYLRTRRTLRP*
Ga0066708_101567482	3300005576	Soil	MPQSIPQNGGYMIAAYIVAAVILVGYGLSLYLRARRSLRA*
Ga0066708_102555252	3300005576	Soil	MPETLPQNAGYMIAAYIVVAVIMVGYAASLFQRGRKL*
Ga0066691_101735793	3300005586	Soil	GMPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRA*
Ga0066706_115201121	3300005598	Soil	MHETVPQNGGYMIAAYIVVAAILSGYALSLYLRARRSLRA*
Ga0066905_1000044557	3300005713	Tropical Forest Soil	MPDAVPQNGGFMIAAYVIAAVILGGYALSLYLRARRSLRP*
Ga0066905_1010157552	3300005713	Tropical Forest Soil	MQAVPQNAGYMIAAYVITGAILLGYTLSLYLRARRSLRP*
Ga0068858_1017900811	3300005842	Switchgrass Rhizosphere	GGRVMQTVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP*
Ga0075300_10475952	3300005876	Rice Paddy Soil	MMLPQTPPQNSGYMIAAYVIAGAILLGYTLSLYLRARRSLRP*
Ga0066651_100127784	3300006031	Soil	MTTQGPPPNSGYMIAAYILVGVILIGYTLSLYLRARRSLRP*
Ga0066651_104476252	3300006031	Soil	MTPQNGGYMIAAYVVVAAILVGYTLSLYLRARRSLR
Ga0066656_100218945	3300006034	Soil	MPENGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP*
Ga0066652_1002230032	3300006046	Soil	MPENGGYMIAAYVVVGAILIGYTLSLYLRARRSFRA*
Ga0066652_1004515732	3300006046	Soil	MTPQNGGYMIAAYVVVAAILVGYTLSLYLRARRSLRS*
Ga0066658_103097062	3300006794	Soil	MLQAPAPPQNGGYMIAAYSVAAGILIGYAVSLYLRARRSLRA*
Ga0066665_111780242	3300006796	Soil	MYDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA*
Ga0066659_100544025	3300006797	Soil	MPDTVPQNGGYMVGAYVVAAVILISYALSLYLRTRRTLRP*
Ga0075428_10000108722	3300006844	Populus Rhizosphere	MPESIPQNGGYMIAAYVIVAVILAGYALSLYLRTRRSLRA*
Ga0075428_1000895855	3300006844	Populus Rhizosphere	MQTVPQNAGYMIAAYVVAGAIVLGYALSLYLRTRRSLRP*
Ga0075421_1000547384	3300006845	Populus Rhizosphere	MQVPEAVPQNGGYMVAAYIVVAVVILGYALSLYLRTRRSLRP*
Ga0075421_1002748403	3300006845	Populus Rhizosphere	VPETVPQNAGYMIAAYVIAGAIVLGYALSLYLRARRSLRP*
Ga0075421_1005193022	3300006845	Populus Rhizosphere	MPESVPQNGGYLIAAYVIVAVILAGYALSLYLRARRSLRA*
Ga0075430_1008836501	3300006846	Populus Rhizosphere	VPQNAGYMIAAYVIAGAIVLGYALSLYLRARRSLRP*
Ga0075433_100363252	3300006852	Populus Rhizosphere	MPENGSYMIAAYVLVGVILTGYALSLYLRARRSLRP*
Ga0075433_100534704	3300006852	Populus Rhizosphere	MHDVPQNGGYMVAAYITVAVILIGYALSLYLRARRSLRA*
Ga0075433_101707302	3300006852	Populus Rhizosphere	MQAAPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA*
Ga0075433_119451731	3300006852	Populus Rhizosphere	MPENGSYMIAAYIAVAVIVSGYTLSLYLRTRRSLRP*
Ga0075425_1000121284	3300006854	Populus Rhizosphere	MLVQTPPPPQNGGYMIAAYILVGAILIGYTVSLYLRARRSLRP*
Ga0075425_1003671343	3300006854	Populus Rhizosphere	MPENGGYMIAAYIVVGAILSGYTLSLYLRARRSLRA*
Ga0075425_1027828852	3300006854	Populus Rhizosphere	MPENGGYMIAAYIVVGAILGGYTLSLYLRARRSLRA*
Ga0073934_101031992	3300006865	Hot Spring Sediment	MPETVPQNAGYMVAAYVVATALLLGYALTLYLRIRKLR*
Ga0075434_1007637752	3300006871	Populus Rhizosphere	MQATPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA*
Ga0075436_1003714831	3300006914	Populus Rhizosphere	PQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA*
Ga0079216_101517792	3300006918	Agricultural Soil	MPETIPQNAGFMIAAYVVAGAIILGYALSLYLRSRKL*
Ga0099791_100212822	3300007255	Vadose Zone Soil	MPENGNYMIAAYILVGVILVGYALSLYLRARRSLRP*
Ga0099794_100281555	3300007265	Vadose Zone Soil	MPESVPQNGGYMIAAYILVGVILVGYALSLYLRARRSLRP*
Ga0066710_1000270743	3300009012	Grasslands Soil	MQDVPQNGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP
Ga0066710_1003179173	3300009012	Grasslands Soil	MPETIAQNGSFMIAAYIVAAVILIGYSLSLYLRARRSLRA
Ga0099830_105267351	3300009088	Vadose Zone Soil	MPETVPQNAPYMVAAYVVAAVILLLYTVTLWLRGPKPP
Ga0099828_100037373	3300009089	Vadose Zone Soil	MPETIPQNGGYMIAAYIVAAVILVGYAISLHLRARRSLRP*
Ga0099827_100097517	3300009090	Vadose Zone Soil	MPETIPQNGGYMIAAYIVAAVILIGYALSLYLRARRSLRA*
Ga0099827_115031522	3300009090	Vadose Zone Soil	MPETVPQNGGYLVAAYIVVAVILIGYALSLYLRARRSLRP*
Ga0111539_103301952	3300009094	Populus Rhizosphere	MQTVPQNAGYMIAAYVIAGAIVLGYALSLYLRTRRSLRP*
Ga0111538_100604911	3300009156	Populus Rhizosphere	RVMQTVPQNAGYMIAAYVIAGAIVLGYALSLYLRTRRSLRP*
Ga0111538_116784542	3300009156	Populus Rhizosphere	MQPVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP*
Ga0105259_10435692	3300009597	Soil	MQAPVPQNAGYMIAAYVITGAILLGYALSLYLRARRSLRS*
Ga0105252_100033725	3300009678	Soil	MPETVPQNAGYMIAAYVITGVILIGYTLSLYLRARRSLRP*
Ga0105063_10126961	3300009804	Groundwater Sand	MPETVPQNAGYMVAAYIVAGAILIGYALSLYLRARRSLRA*
Ga0126380_116346981	3300010043	Tropical Forest Soil	VIQTPPQNGGYMIAAYILVGAILIGYTLSLYLRARRSLRS*
Ga0126382_120481492	3300010047	Tropical Forest Soil	MPDAVPQNGGFMIAAYVIAAVILGGYALSLYLRARRSLRPQS
Ga0099796_105168822	3300010159	Vadose Zone Soil	MPETVPQNGSYMIAAYILVGVILVGYALSLYLRARRSLRP*
Ga0134070_101844482	3300010301	Grasslands Soil	MHDVPQNGGFMIAAYITVALILIGYALSLYLRARRSLRA*
Ga0134109_100135193	3300010320	Grasslands Soil	MPETVPQNGGYMIAAYIVVAAILIGYTVSLYLRARRSLRA*
Ga0134109_102208571	3300010320	Grasslands Soil	MPENGGYMIAAYVVVAAILIGYTLSLYLRARRSFRA*
Ga0134064_100861243	3300010325	Grasslands Soil	MTTQGPPPNSGYMIAAYILVGVILIGYTVSLYLRARRSLRA*
Ga0137457_10524012	3300011443	Soil	MPETVPPNGGYMIAAYIVTAVILAGYALSLYLRARRSLRA*
Ga0137389_102701242	3300012096	Vadose Zone Soil	MPETVPQNGNYMIVAYILVGVILVGYAVSLYLRARRSLRP*
Ga0137389_106263531	3300012096	Vadose Zone Soil	MLEQVPRNGGYMVAAYIVAAGILIGYAVSLYLRARRGLRA*
Ga0137364_106323942	3300012198	Vadose Zone Soil	MTPQNGGYMIAAYVVVAAILIGYTLSLYLRARRSLRS*
Ga0137383_101358911	3300012199	Vadose Zone Soil	MPENGNYMIAAYILVGAILSGYALSLYLRARRSLRP*
Ga0137383_106933471	3300012199	Vadose Zone Soil	MPDTVPQNGGYMVAAYVVAAGILISYAVSLYLRTRRSLRP*
Ga0137383_110226241	3300012199	Vadose Zone Soil	MPNTVPQNGGYMIAAYVAAAVILIGYTLSLYLRARRSFRA*
Ga0137382_100236467	3300012200	Vadose Zone Soil	MPENGNYMIAAYILVGVILVGYALSLYLRARRSLRA*
Ga0137382_101184144	3300012200	Vadose Zone Soil	MPENGNYMIAAYIMTAVILVGYALSLYLRTRRSLRP*
Ga0137382_106226262	3300012200	Vadose Zone Soil	MPENGNYMIAAYILVGVILVGYGLSLYLRTRRSLRP*
Ga0137365_101518064	3300012201	Vadose Zone Soil	MPEQIPQNGGYMVAAYVVAAVILIGYTLSLYLRARRSFRA*
Ga0137363_101949994	3300012202	Vadose Zone Soil	MPENGGYMIAAYVVVAAILIGYALSLYLRARRSFRA*
Ga0137399_101458591	3300012203	Vadose Zone Soil	MPENGGYMVAAYVVVAVIMLGYALSLYLRTRRSFRA*
Ga0137399_105728722	3300012203	Vadose Zone Soil	MPENGNYMIAAYILVGIILGGYALSLYLRARRSLRP*
Ga0137399_109950532	3300012203	Vadose Zone Soil	MPDNGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP*
Ga0137374_109028301	3300012204	Vadose Zone Soil	MLETVPQTGGYMIAAYIVVAVILVGYTLSLYLRARRSLRA*
Ga0137380_101567643	3300012206	Vadose Zone Soil	MPENGNYMIAAYILVGVILVGYALSLHLRARRSLRP*
Ga0137376_108740462	3300012208	Vadose Zone Soil	MPETLPQNAGYMIAAYIVVAVIMLGYAASLFQRGRKL*
Ga0137376_109955092	3300012208	Vadose Zone Soil	MTEAVPQNGNYMIAAYILVGVILVGYALSLYLRTRRSLRP*
Ga0137376_111250712	3300012208	Vadose Zone Soil	MPETVPQNGGYMIAAYIVVAAILIGYTLSLYLRARRSLRA*
Ga0137377_119128431	3300012211	Vadose Zone Soil	MPQSIPQNGGYMIAAYIVAAVILVAYALALYLRARRSLRA*
Ga0137370_100045975	3300012285	Vadose Zone Soil	MPENGNYMIAAYILVGVILGGYALSLYLRARRSLRP*
Ga0137386_108584091	3300012351	Vadose Zone Soil	RRWEKWGRGMPENGGYMIAAYIVVGVILVGYALSLYLRARRSLRA*
Ga0137368_100323374	3300012358	Vadose Zone Soil	MLENGGYMIAAYIVVGVILVGYALSLYLRARRSLRA*
Ga0137375_101212913	3300012360	Vadose Zone Soil	MPENGGYMIAAYIVVGVILVGYALSLYLRARRSLRA*
Ga0137360_104160873	3300012361	Vadose Zone Soil	MTQTVPQNGGYMIAAYIVVAVILIGYTLSLYLRARRSLRA*
Ga0137361_104814773	3300012362	Vadose Zone Soil	MPETVPQNGGYLVAAYIVVAVILIGYTLSLYLRARRSLRA*
Ga0137397_100179283	3300012685	Vadose Zone Soil	MPENGGYMIAAYIVAAVIIVGYALSLYLRARRSLRP*
Ga0137395_106926352	3300012917	Vadose Zone Soil	MPENGNYMIAAYILGGVILVGYALSLYLRTRRSLR
Ga0137396_102207503	3300012918	Vadose Zone Soil	MPETVPQNGGYMIAAYVLVGVILVGYALSLYLRARRSLRA*
Ga0137359_110292261	3300012923	Vadose Zone Soil	MPENGNYMIAAYILVGIILSGYALSLYLRARRNLRP*
Ga0137413_112245142	3300012924	Vadose Zone Soil	MQNVPQNGGYMVAAYILVAVIIAGYALSLYLRARRSLRP*
Ga0137410_107354761	3300012944	Vadose Zone Soil	MPENGGYMIAAYVVAAVIILGYALSLYLRARRSLRP*
Ga0134076_101694312	3300012976	Grasslands Soil	MPENGNYMIAAYILVGIILVGYALSLYLRARRSLRP*
Ga0134076_103418571	3300012976	Grasslands Soil	MPETIPQNGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP*
Ga0134078_100341634	3300014157	Grasslands Soil	MPETVPQNGGYMIAAYIVVAAILIGYTVSLYLRARRSLRA
Ga0137420_12681893	3300015054	Vadose Zone Soil	MPENGNYMIAAYILVGVILVGYALSLYLRARRSLRP
Ga0137409_103115143	3300015245	Vadose Zone Soil	MPDAVPQNGGYMIAAYVVAAIILIGYTLSLYLRARRSFRA*
Ga0180089_10425932	3300015254	Soil	MTETVPQNAGYMIAAYIVTGVILIGYALSLYLRARRSLRA*
Ga0134072_103212932	3300015357	Grasslands Soil	MPETLPQNAGYMIAAYIVVAVIMLGYAASLFQRGRK
Ga0134112_100153182	3300017656	Grasslands Soil	MPETIPQNGSFMIAAYIVAAVILIGYSLSLYLRARRSLRA
Ga0134112_102515862	3300017656	Grasslands Soil	MPENGNYMIAAYILVGIILVGYALSLYLRARRSLRP
Ga0134112_102666322	3300017656	Grasslands Soil	MPQSMPQNGGYMVAAYIVAGAILIGYAVSLYLRTRRSLRA
Ga0134083_103341862	3300017659	Grasslands Soil	MPENGGYMIAAYIVVGVILVGYALSLYLRARRSLRA
Ga0184610_10126944	3300017997	Groundwater Sediment	MPETVPQNAGYMIAAYIVAGVILIGYALSLYLRARRSLRA
Ga0184610_10274423	3300017997	Groundwater Sediment	MTETVPQNAGYMIAAYIVTGVILIGYALSLYLRARRSLRA
Ga0184608_100452013	3300018028	Groundwater Sediment	MPENGNYMSAAYILGGVILVGYALSLYLRTRRSLRP
Ga0184621_100181604	3300018054	Groundwater Sediment	MPENGNYMIAAYILVGVILAGYALSLYLRTRRSLRP
Ga0184623_100590082	3300018056	Groundwater Sediment	MPETVPQNAGYMIAAYMVAGAILIGYALSLYLRARRSLRA
Ga0184618_100638313	3300018071	Groundwater Sediment	MPETVPQNGGYMIAAYILVGVILAGYALSLYLRARRSLRP
Ga0184609_100147725	3300018076	Groundwater Sediment	MPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRP
Ga0184629_100709663	3300018084	Groundwater Sediment	MPETVPQNGGYMIAAYIVAGVILLGYALSLYLRARRSLRA
Ga0184629_104922662	3300018084	Groundwater Sediment	MPETVPQNGSYMIAAYILVGVILVGYTVSLYLRARRSLRP
Ga0066655_100346965	3300018431	Grasslands Soil	DMPDTVPQNGGYMVGAYVVAAVILISYALSLYLRTRRSLRA
Ga0066667_100180713	3300018433	Grasslands Soil	MPQSIPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA
Ga0066667_111915732	3300018433	Grasslands Soil	MPETVPENGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP
Ga0066667_117741512	3300018433	Grasslands Soil	MPENGNYMIAAYILVGVILSGYALSLYLRARRSLRP
Ga0066667_117749932	3300018433	Grasslands Soil	MPETVPQNGSYMIAAYILVGVILAGYALLLYLRARRSLRP
Ga0066662_100503191	3300018468	Grasslands Soil	MPDTVPQNGGYMVAAYVVGAVVLISYALSLYLRTRPRLPA
Ga0066662_101114033	3300018468	Grasslands Soil	MLEQVPQNGGYMIAAYSVAAGILIGYAVSLYLRARRSLRA
Ga0066669_100417264	3300018482	Grasslands Soil	MHDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA
Ga0066669_100741203	3300018482	Grasslands Soil	MPEAVPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP
Ga0066669_100794593	3300018482	Grasslands Soil	MTPQNGGYMIAAYVVVAAILVGYTLSLYLRARRSLRS
Ga0066669_101359024	3300018482	Grasslands Soil	MTTQGPPPNSGYMIAAYILVGVILIGYTLSLYLRARRSLRP
Ga0066669_102071753	3300018482	Grasslands Soil	MPENGTYMIAAYILVGVILVGYALSLYLRTRRSLRP
Ga0066669_102337412	3300018482	Grasslands Soil	MPENGGYMIAAYVVVGAILIGYTLSLYLRARRSFRA
Ga0066669_104482122	3300018482	Grasslands Soil	MPQTPAPPQNGGYMIAAYCIVGAIFIVYTLSLYLRARRSLRP
Ga0066669_110381442	3300018482	Grasslands Soil	MPEILPQNAGYMIAAYIVVAVIMVGYAASLFQRGRKL
Ga0066669_115557412	3300018482	Grasslands Soil	MPETVPQNGSYMIAAYILVGLILGGYALLLYLRARRSLRP
Ga0187894_105237192	3300019360	Microbial Mat On Rocks	VVPDNAGYMIAAYVATAAILLGYALSLVLRANKVKE
Ga0193722_10034985	3300019877	Soil	MPENGGYMIAAYVVVGAILIGYSLSLYLRARRSLRA
Ga0193723_100027521	3300019879	Soil	MPENGSYMIAAYVLVGVILTGYALSLYLRARRSLRP
Ga0193723_100051317	3300019879	Soil	MPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRA
Ga0193725_10565712	3300019883	Soil	MPENGNYMIAAYMLVGVILVGYALSLYLRTRRSLRP
Ga0193733_11746312	3300020022	Soil	MPESVPQNGGYMIAAYVLVGVILVGYALSLYLRARRGLRP
Ga0210379_103917932	3300021081	Groundwater Sediment	MTETVPQNAGYMIAAYIVTGVMLIGYALSLYLRARRSLRA
Ga0179596_101717932	3300021086	Vadose Zone Soil	MPENGNYMIAAYILGGVILVGYALSLYLRTRRSLRP
Ga0193719_101534492	3300021344	Soil	MPESVPQNATYMIAAYILVGVILIGYALLLYLRARRSLRP
Ga0193695_10281642	3300021418	Soil	MPETVPQNGSYMIAAYILVGVILAGYALSLYLRARRSLRP
Ga0137417_10705942	3300024330	Vadose Zone Soil	MPENGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP
Ga0209341_102665163	3300025325	Soil	VPTDLPHNAGYMIAAYLVTAVIILGYSVSLVVRARRARTD
Ga0207653_1000006046	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	MPENGGYMIAAYIVVGAILSGYTLSLYLRARRSLRA
Ga0207653_100983592	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	MPENGNYMIAAYILVGVILTGYALSLYLRARRSLRP
Ga0207684_102593602	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MLEQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA
Ga0207684_109173503	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MPQAAPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA
Ga0207707_112590431	3300025912	Corn Rhizosphere	ISDMPEVPQNAGYMIAAYIVAGAILFGYALSLYLRSRKL
Ga0207660_102057082	3300025917	Corn Rhizosphere	MQAPVPQNGGYMIAAYIVTGVIVVGYAVSLYLRARRALRP
Ga0207660_102596712	3300025917	Corn Rhizosphere	MPEAVPQNAGYMIAAYIIVAVILGGYALSLYLRTRRSLRA
Ga0207660_116983241	3300025917	Corn Rhizosphere	MPEVPQNAGYMIAAYIVAGAILFGYALSLYLRSRKL
Ga0207662_101099802	3300025918	Switchgrass Rhizosphere	MPETVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRALRP
Ga0207689_108447062	3300025942	Miscanthus Rhizosphere	MQTVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP
Ga0210090_10634052	3300025965	Natural And Restored Wetlands	MQSVPQNAGYMIAAYILTGAILLGYTLSLYLRARRSLRS
Ga0208141_10141021	3300025988	Rice Paddy Soil	MMLPQTPPQNSGYMIAAYVIAGAILLGYTLSLYLRARRSLRP
Ga0209438_100076915	3300026285	Grasslands Soil	MPETVPQNGGYMVAAYIIVAVITVGYTLSLYLRARRSFRA
Ga0209438_11219182	3300026285	Grasslands Soil	MPENGNYMIAAYILSGVILVGYALSLYLRTRRSLRP
Ga0209234_10173613	3300026295	Grasslands Soil	MPETLPQNAGYMIAAYIVVAVIMLGYAASLFQRGRKL
Ga0209235_100033819	3300026296	Grasslands Soil	MPETIPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA
Ga0209235_10093135	3300026296	Grasslands Soil	MPDTVPQNGGYMVAAYVVAAVILISYAVSLYLRTRRSLRP
Ga0209235_12262992	3300026296	Grasslands Soil	MPETVPQNGGYLVAAYIVVAVILIGYALSLHLRARRSLRA
Ga0209235_12560462	3300026296	Grasslands Soil	MPEAVPQNAGFMIAAYILVGVILVGYALSLYLRARRSLRP
Ga0209027_10440961	3300026300	Grasslands Soil	MLQVPGPPQNGGYMIAAYCIVGAIFIVYTLSLYLRARRSLRP
Ga0209688_10943102	3300026305	Soil	PQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP
Ga0209153_10373623	3300026312	Soil	MPETVPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP
Ga0209470_10189002	3300026324	Soil	MTPQNGGYMIAAYVVVAAILIGYTLSLYLRARRSLRS
Ga0209470_11593772	3300026324	Soil	MRDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA
Ga0209266_10025229	3300026327	Soil	MPDTVPQNGGYMVGAYVVAAVILISYALSLYLRTRRSLRA
Ga0209266_10879742	3300026327	Soil	MPENGNYMIAAYILVGVILVGYGLSLYLRTRRSLRP
Ga0209804_12471222	3300026335	Soil	MPDTVPQNGSYMIAAYILVGVILAGYALLLYLRARRSLRP
Ga0209378_10095013	3300026528	Soil	MPESVPQNGGYMIAAYIVAGAILVSYALSLYLRARRSLRP
Ga0209378_10136833	3300026528	Soil	MHETVPQNGGYMIAAYIVVAAILIGYALSLYLRARRSLRA
Ga0209378_12569602	3300026528	Soil	MPQSIPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA
Ga0209807_10208902	3300026530	Soil	MPETFPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP
Ga0209807_11224563	3300026530	Soil	MLEQVPQNGGYMVAAYIVAAGILIGYAVSLYLRARRSLRA
Ga0209807_11626681	3300026530	Soil	MPETVPQNGGYMVAAYVVAAVILLSYAVSLYLRTRRSLRP
Ga0209058_10034932	3300026536	Soil	MPETIPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA
Ga0209157_10220957	3300026537	Soil	MPENGNYMIAAYILVGVILAGYALSLYLRARRSLRP
Ga0209056_1000853715	3300026538	Soil	MPETVPQNGGYMIAAYIVAGAILVSYALSLYLRARRSLRP
Ga0209056_100371446	3300026538	Soil	MPQSIPQNGGYMIAAYIVAAVILVGYGLSLYLRARRSLRA
Ga0209376_12024991	3300026540	Soil	IPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA
Ga0209161_105754622	3300026548	Soil	MHETVPQNGGYMIAAYIVVAAILSGYALSLYLRARRSLRA
Ga0208454_100102116	3300027573	Soil	MPETVPQNAGYMIAAYVITGVILIGYTLSLYLRARRSLRP
Ga0208454_10153353	3300027573	Soil	MQAPVPQNAGYMIAAYVITGAILLGYALSLYLRARRSLRS
Ga0209076_11099132	3300027643	Vadose Zone Soil	MPETVPQNGGYMIAAYVLVGVILVGYALSLYLRARRSLRA
Ga0209388_10780832	3300027655	Vadose Zone Soil	MPENGNYMIAAYILVGVILFGYALSLYLRARRSLRP
Ga0209588_100047010	3300027671	Vadose Zone Soil	MPESVPQNGGYMIAAYILVGVILVGYALSLYLRARRSLRP
Ga0209485_11059612	3300027691	Agricultural Soil	MPETIPQNAGFMIAAYVVAGAIILGYALSLYLRSRKL
Ga0208989_102454052	3300027738	Forest Soil	MPETVPQNASYMIAAYILVGVILAGYALSLYLRARRSLRP
Ga0209166_100052497	3300027857	Surface Soil	MLSDTPQNGGYMIAAYVVAAVILLGYTLSLYLRARRSLRP
Ga0209283_100050707	3300027875	Vadose Zone Soil	MPETIPQNGGYMIAAYIVAAVILVGYAISLHLRARRSLRP
Ga0209590_100012975	3300027882	Vadose Zone Soil	MPETIPQNGGYMIAAYIVAAVILIGYALSLYLRARRSLRA
Ga0209590_100465934	3300027882	Vadose Zone Soil	MPENGGYMIAAYVVVGAILIGYTLSLYLRARRSLRA
Ga0209590_102900243	3300027882	Vadose Zone Soil	MHETVPQNGGYMIAAYIVVAAILIGYALSLYLRARR
Ga0209488_100442746	3300027903	Vadose Zone Soil	MSETVPQNGNYMIAAYILVGVILAGYALSLYLRARRSLRP
Ga0209382_100997522	3300027909	Populus Rhizosphere	MPESIPQNGGYMIAAYVIVAVILAGYALSLYLRTRRSLRA
Ga0209382_101283713	3300027909	Populus Rhizosphere	VPETVPQNAGYMIAAYVIAGAIVLGYALSLYLRARRSLRP
Ga0209382_104145222	3300027909	Populus Rhizosphere	MPESVPQNGGYLIAAYVIVAVILAGYALSLYLRARRSLRA
Ga0209382_108808042	3300027909	Populus Rhizosphere	MQVPEAVPQNGGYMVAAYIVVAVVILGYALSLYLRTRRSLRP
Ga0247663_10807691	3300028145	Soil	MQTVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFR
Ga0137415_100287645	3300028536	Vadose Zone Soil	MPETVPQNGGYLVAAYIVVAVILIGYALSLYLRARRSLRP
Ga0137415_102084222	3300028536	Vadose Zone Soil	MPETVPQNGSYMIAAYILVGVILIGYALSLYLRARRSLRP
Ga0137415_103760073	3300028536	Vadose Zone Soil	MPENGNYMIAAYILVGIILGGYALSLYLRARRSLRP
Ga0307307_101373122	3300028718	Soil	MPESVPQNATYMIAAYILVGVILTGYALSLYLRARRCLRP
Ga0307296_104405351	3300028819	Soil	MPETVPQNAGYMIAAYILVGVILTGYALSLYLRARRSLRP
Ga0307308_100950303	3300028884	Soil	MPENGNYMIAAYIVAAVILIGYALSLYLRTRRSLRP
Ga0307308_102321123	3300028884	Soil	PLEKWDMPESVPQNATYMIAAYILVGVILTGYALSLYLRARRCLRP
Ga0073997_107194142	3300030997	Soil	MPETVPQNGGFMIAAYIITAVILGGYALSLYMRTRRSLRA
Ga0307498_100515592	3300031170	Soil	MTPPNGGYMIAAYVVVAAILIGYTLSLYLRARRSLRS
Ga0307495_101668142	3300031199	Soil	MPETVPQNAGYMIAAYIIAGTILVSYAVSLYLRARRALRP
Ga0307505_100168973	3300031455	Soil	MQASPPDNAGYMIVAYLVTAVIVVGYAWSLWVRSKR
Ga0310813_100053839	3300031716	Soil	MMQATPENGGYMIAAYVIAAVVLVTYAVSLYWRTRKL
Ga0307469_100125445	3300031720	Hardwood Forest Soil	MLDQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA
Ga0307469_112142061	3300031720	Hardwood Forest Soil	MLEQVPQNGGYMVAAYVVAAGILIGYAVSLYLRARRSLRA
Ga0307468_1009681822	3300031740	Hardwood Forest Soil	MPEAIPQNAGYMIAAYIIVAVILGGYALSLYLRTRRSLRA
Ga0307473_103891961	3300031820	Hardwood Forest Soil	VMPQAAPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA
Ga0307473_108523352	3300031820	Hardwood Forest Soil	MMLQAPPSNGGYMVAAYVLAGAILIGYTLSLYLRARRSLRP
Ga0307473_112672582	3300031820	Hardwood Forest Soil	MHDVPQNGGYMIAAYITVAVILIGYALSLYLRARRSLRA
Ga0326597_101297783	3300031965	Soil	VPTDLPQNAGYMIAAYLVTAVIILGYSVSLLVRARRARTD
Ga0326597_104010812	3300031965	Soil	VPTELPDNAGYMIAAYLVTAVIILGYSVSLMVRARRAGTD
Ga0307471_1014822732	3300032180	Hardwood Forest Soil	MLEQVPQNGGYMVAAYILAAGILIGYAVSLYLRARRSLRA
Ga0307471_1017120042	3300032180	Hardwood Forest Soil	MPETVPQNAGYMIAAYVITGAILFGYALSLYLRARRSLRP
Ga0307471_1019118451	3300032180	Hardwood Forest Soil	MLEQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARR
Ga0307471_1033031381	3300032180	Hardwood Forest Soil	WDMLDQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA
Ga0307472_1008935172	3300032205	Hardwood Forest Soil	REESVMPEAVPQNAGYMIAAYIIVAVILGGYALSLYLRTSRSLRA
Ga0335085_1002200113	3300032770	Soil	MAETIPQNGGYMVAAYIVAAVILVGYALSLYRRSR
Ga0214472_1001421510	3300033407	Soil	MLQNVPQNAGYMIAAYIVAGAILIGYGLSLYLRARRSLRA
Ga0364928_0009579_257_379	3300033813	Sediment	MPETVPQNGGYMIAAYIVTAVILTGYALSLYLRARRSLRA
Ga0364934_0070339_611_730	3300034178	Sediment	MPDVPQNAGYMIAAYIVAGVILIGYALSLYLRARRSLRA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F012004

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences