Basic Information | |
---|---|
Family ID | F011647 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 288 |
Average Sequence Length | 46 residues |
Representative Sequence | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKEVIKGSK |
Number of Associated Samples | 130 |
Number of Associated Scaffolds | 288 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 74.31 % |
% of genes near scaffold ends (potentially truncated) | 27.43 % |
% of genes from short scaffolds (< 2000 bps) | 73.26 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (44.792 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (16.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.639 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.278 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.67% Coil/Unstructured: 77.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 288 Family Scaffolds |
---|---|---|
PF13252 | DUF4043 | 1.74 |
PF01391 | Collagen | 1.39 |
PF02467 | Whib | 1.04 |
PF13481 | AAA_25 | 0.69 |
PF07659 | DUF1599 | 0.69 |
PF13155 | Toprim_2 | 0.69 |
PF01476 | LysM | 0.69 |
PF05257 | CHAP | 0.35 |
PF10263 | SprT-like | 0.35 |
PF00041 | fn3 | 0.35 |
PF01583 | APS_kinase | 0.35 |
PF13578 | Methyltransf_24 | 0.35 |
PF13506 | Glyco_transf_21 | 0.35 |
PF13230 | GATase_4 | 0.35 |
PF12705 | PDDEXK_1 | 0.35 |
COG ID | Name | Functional Category | % Frequency in 288 Family Scaffolds |
---|---|---|---|
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.35 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.21 % |
Unclassified | root | N/A | 44.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001850|RCM37_1033906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA024-D14 | 2715 | Open in IMG/M |
3300002298|B570J29599_1001849 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300002408|B570J29032_109195768 | Not Available | 631 | Open in IMG/M |
3300002835|B570J40625_100361326 | All Organisms → Viruses → Predicted Viral | 1433 | Open in IMG/M |
3300003277|JGI25908J49247_10034914 | Not Available | 1396 | Open in IMG/M |
3300003394|JGI25907J50239_1041707 | Not Available | 952 | Open in IMG/M |
3300003499|JGI25930J51415_1029069 | Not Available | 1004 | Open in IMG/M |
3300004240|Ga0007787_10365638 | Not Available | 717 | Open in IMG/M |
3300004797|Ga0007764_11008477 | All Organisms → Viruses | 510 | Open in IMG/M |
3300005527|Ga0068876_10062862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2247 | Open in IMG/M |
3300005527|Ga0068876_10065264 | All Organisms → Viruses → Predicted Viral | 2200 | Open in IMG/M |
3300005527|Ga0068876_10087739 | Not Available | 1863 | Open in IMG/M |
3300005527|Ga0068876_10100155 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
3300005527|Ga0068876_10125286 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
3300005527|Ga0068876_10163796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
3300005527|Ga0068876_10211366 | All Organisms → Viruses → Predicted Viral | 1122 | Open in IMG/M |
3300005527|Ga0068876_10234511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1056 | Open in IMG/M |
3300005527|Ga0068876_10501613 | Not Available | 666 | Open in IMG/M |
3300005527|Ga0068876_10585312 | Not Available | 605 | Open in IMG/M |
3300005527|Ga0068876_10609333 | Not Available | 591 | Open in IMG/M |
3300005528|Ga0068872_10211866 | Not Available | 1101 | Open in IMG/M |
3300005528|Ga0068872_10482314 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005581|Ga0049081_10000818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11817 | Open in IMG/M |
3300005581|Ga0049081_10018452 | All Organisms → Viruses → Predicted Viral | 2645 | Open in IMG/M |
3300005581|Ga0049081_10089277 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
3300005662|Ga0078894_11643440 | All Organisms → Viruses | 529 | Open in IMG/M |
3300005662|Ga0078894_11694254 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005739|Ga0076948_1115231 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
3300005805|Ga0079957_1032997 | All Organisms → Viruses → Predicted Viral | 3399 | Open in IMG/M |
3300005805|Ga0079957_1036635 | Not Available | 3169 | Open in IMG/M |
3300006805|Ga0075464_10668357 | Not Available | 641 | Open in IMG/M |
3300006805|Ga0075464_10711768 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300006805|Ga0075464_11032331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 517 | Open in IMG/M |
3300007214|Ga0103959_1087391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5205 | Open in IMG/M |
3300007538|Ga0099851_1024966 | Not Available | 2408 | Open in IMG/M |
3300007538|Ga0099851_1160465 | Not Available | 833 | Open in IMG/M |
3300007541|Ga0099848_1032454 | Not Available | 2170 | Open in IMG/M |
3300007541|Ga0099848_1046654 | Not Available | 1757 | Open in IMG/M |
3300007541|Ga0099848_1122761 | Not Available | 980 | Open in IMG/M |
3300007734|Ga0104986_1600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18834 | Open in IMG/M |
3300007735|Ga0104988_10309 | Not Available | 13308 | Open in IMG/M |
3300007735|Ga0104988_10930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39708 | Open in IMG/M |
3300007960|Ga0099850_1262984 | Not Available | 662 | Open in IMG/M |
3300008072|Ga0110929_1011958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9046 | Open in IMG/M |
3300008107|Ga0114340_1002303 | Not Available | 11261 | Open in IMG/M |
3300008107|Ga0114340_1030300 | Not Available | 2487 | Open in IMG/M |
3300008107|Ga0114340_1033066 | All Organisms → Viruses → Predicted Viral | 2868 | Open in IMG/M |
3300008107|Ga0114340_1069141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1491 | Open in IMG/M |
3300008107|Ga0114340_1122666 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
3300008107|Ga0114340_1164472 | Not Available | 798 | Open in IMG/M |
3300008107|Ga0114340_1252848 | Not Available | 537 | Open in IMG/M |
3300008107|Ga0114340_1265462 | Not Available | 514 | Open in IMG/M |
3300008108|Ga0114341_10156410 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
3300008108|Ga0114341_10298441 | Not Available | 839 | Open in IMG/M |
3300008108|Ga0114341_10416710 | Not Available | 643 | Open in IMG/M |
3300008110|Ga0114343_1057131 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
3300008110|Ga0114343_1058102 | Not Available | 1465 | Open in IMG/M |
3300008110|Ga0114343_1142065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 777 | Open in IMG/M |
3300008110|Ga0114343_1206136 | Not Available | 562 | Open in IMG/M |
3300008113|Ga0114346_1169781 | Not Available | 908 | Open in IMG/M |
3300008114|Ga0114347_1003030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12413 | Open in IMG/M |
3300008114|Ga0114347_1003163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11683 | Open in IMG/M |
3300008114|Ga0114347_1009860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5287 | Open in IMG/M |
3300008114|Ga0114347_1109766 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
3300008114|Ga0114347_1134805 | Not Available | 906 | Open in IMG/M |
3300008114|Ga0114347_1159886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300008116|Ga0114350_1008059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5340 | Open in IMG/M |
3300008116|Ga0114350_1035592 | All Organisms → Viruses → Predicted Viral | 1929 | Open in IMG/M |
3300008116|Ga0114350_1038859 | Not Available | 1817 | Open in IMG/M |
3300008116|Ga0114350_1087914 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
3300008116|Ga0114350_1138265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 702 | Open in IMG/M |
3300008116|Ga0114350_1145107 | Not Available | 672 | Open in IMG/M |
3300008116|Ga0114350_1170140 | Not Available | 576 | Open in IMG/M |
3300008116|Ga0114350_1196500 | Not Available | 502 | Open in IMG/M |
3300008117|Ga0114351_1225812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 952 | Open in IMG/M |
3300008117|Ga0114351_1366343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300008117|Ga0114351_1414749 | Not Available | 563 | Open in IMG/M |
3300008119|Ga0114354_1001166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19765 | Open in IMG/M |
3300008120|Ga0114355_1079195 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
3300008259|Ga0114841_1001141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15204 | Open in IMG/M |
3300008262|Ga0114337_1173799 | Not Available | 907 | Open in IMG/M |
3300008263|Ga0114349_1104262 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
3300008264|Ga0114353_1327358 | Not Available | 613 | Open in IMG/M |
3300008265|Ga0114361_1040400 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
3300008266|Ga0114363_1008123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5116 | Open in IMG/M |
3300008266|Ga0114363_1041613 | All Organisms → Viruses → Predicted Viral | 1875 | Open in IMG/M |
3300008266|Ga0114363_1101365 | Not Available | 1034 | Open in IMG/M |
3300008266|Ga0114363_1111503 | Not Available | 967 | Open in IMG/M |
3300008266|Ga0114363_1113083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 956 | Open in IMG/M |
3300008266|Ga0114363_1129676 | Not Available | 864 | Open in IMG/M |
3300008266|Ga0114363_1161833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300008266|Ga0114363_1191272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300008339|Ga0114878_1127041 | Not Available | 946 | Open in IMG/M |
3300008448|Ga0114876_1124689 | Not Available | 981 | Open in IMG/M |
3300008448|Ga0114876_1165786 | Not Available | 788 | Open in IMG/M |
3300008448|Ga0114876_1219712 | Not Available | 622 | Open in IMG/M |
3300008450|Ga0114880_1052283 | All Organisms → Viruses → Predicted Viral | 1722 | Open in IMG/M |
3300008450|Ga0114880_1057863 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
3300008450|Ga0114880_1127974 | Not Available | 944 | Open in IMG/M |
3300008450|Ga0114880_1131712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
3300008450|Ga0114880_1279077 | Not Available | 501 | Open in IMG/M |
3300009085|Ga0105103_10556537 | Not Available | 648 | Open in IMG/M |
3300009151|Ga0114962_10128984 | All Organisms → Viruses → Predicted Viral | 1542 | Open in IMG/M |
3300009152|Ga0114980_10000225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 39940 | Open in IMG/M |
3300009152|Ga0114980_10624926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300009154|Ga0114963_10191210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1190 | Open in IMG/M |
3300009155|Ga0114968_10060886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2395 | Open in IMG/M |
3300009155|Ga0114968_10132881 | All Organisms → Viruses | 1491 | Open in IMG/M |
3300009155|Ga0114968_10217547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
3300009158|Ga0114977_10099821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1761 | Open in IMG/M |
3300009159|Ga0114978_10041744 | All Organisms → Viruses → Predicted Viral | 3213 | Open in IMG/M |
3300009160|Ga0114981_10449659 | Not Available | 691 | Open in IMG/M |
3300009161|Ga0114966_10173679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1385 | Open in IMG/M |
3300009165|Ga0105102_10837220 | Not Available | 526 | Open in IMG/M |
3300009180|Ga0114979_10558080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 657 | Open in IMG/M |
3300009183|Ga0114974_10006680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8517 | Open in IMG/M |
3300009183|Ga0114974_10024778 | All Organisms → Viruses → Predicted Viral | 4197 | Open in IMG/M |
3300009183|Ga0114974_10134683 | All Organisms → Viruses → Predicted Viral | 1558 | Open in IMG/M |
3300009183|Ga0114974_10341147 | Not Available | 871 | Open in IMG/M |
3300009184|Ga0114976_10105437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1606 | Open in IMG/M |
3300009184|Ga0114976_10118623 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
3300009184|Ga0114976_10164528 | All Organisms → Viruses → Predicted Viral | 1236 | Open in IMG/M |
3300009184|Ga0114976_10717476 | Not Available | 500 | Open in IMG/M |
3300009239|Ga0103858_10023774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1367 | Open in IMG/M |
3300010354|Ga0129333_10182305 | All Organisms → Viruses → Predicted Viral | 1915 | Open in IMG/M |
3300010354|Ga0129333_10660266 | Not Available | 902 | Open in IMG/M |
3300010354|Ga0129333_11567700 | Not Available | 538 | Open in IMG/M |
3300010370|Ga0129336_10212695 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
3300010885|Ga0133913_11614773 | All Organisms → Viruses → Predicted Viral | 1635 | Open in IMG/M |
3300010885|Ga0133913_13421326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1039 | Open in IMG/M |
3300011113|Ga0151517_1081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39296 | Open in IMG/M |
3300011116|Ga0151516_10529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18572 | Open in IMG/M |
3300011381|Ga0102688_1601599 | Not Available | 507 | Open in IMG/M |
3300012006|Ga0119955_1004521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6017 | Open in IMG/M |
3300012006|Ga0119955_1103878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
3300012733|Ga0157606_1047208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300012970|Ga0129338_1468583 | Not Available | 539 | Open in IMG/M |
3300013004|Ga0164293_10001079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22821 | Open in IMG/M |
3300013005|Ga0164292_10638629 | Not Available | 684 | Open in IMG/M |
3300013005|Ga0164292_10699258 | Not Available | 647 | Open in IMG/M |
3300013014|Ga0164295_10190686 | All Organisms → Viruses → Predicted Viral | 1528 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10187889 | Not Available | 1315 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10197042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1273 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10065716 | All Organisms → Viruses → Predicted Viral | 2970 | Open in IMG/M |
3300013372|Ga0177922_10026049 | Not Available | 666 | Open in IMG/M |
3300013372|Ga0177922_10314921 | Not Available | 687 | Open in IMG/M |
3300013372|Ga0177922_10406741 | Not Available | 936 | Open in IMG/M |
3300013372|Ga0177922_10602181 | Not Available | 874 | Open in IMG/M |
3300014819|Ga0119954_1004033 | All Organisms → Viruses → Predicted Viral | 4083 | Open in IMG/M |
3300014962|Ga0134315_1065365 | Not Available | 558 | Open in IMG/M |
3300017701|Ga0181364_1059920 | Not Available | 589 | Open in IMG/M |
3300017747|Ga0181352_1090629 | Not Available | 847 | Open in IMG/M |
3300017761|Ga0181356_1234438 | Not Available | 529 | Open in IMG/M |
3300017785|Ga0181355_1258942 | Not Available | 665 | Open in IMG/M |
3300017788|Ga0169931_10540677 | Not Available | 808 | Open in IMG/M |
3300019784|Ga0181359_1007020 | All Organisms → Viruses → Predicted Viral | 3802 | Open in IMG/M |
3300019784|Ga0181359_1097374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
3300019784|Ga0181359_1148614 | Not Available | 806 | Open in IMG/M |
3300019784|Ga0181359_1166624 | Not Available | 741 | Open in IMG/M |
3300019784|Ga0181359_1189987 | Not Available | 670 | Open in IMG/M |
3300019784|Ga0181359_1203601 | Not Available | 635 | Open in IMG/M |
3300020151|Ga0211736_10040480 | Not Available | 535 | Open in IMG/M |
3300020159|Ga0211734_10854277 | Not Available | 673 | Open in IMG/M |
3300020160|Ga0211733_10454565 | Not Available | 547 | Open in IMG/M |
3300020498|Ga0208050_1006718 | Not Available | 1380 | Open in IMG/M |
3300020533|Ga0208364_1000044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33490 | Open in IMG/M |
3300021956|Ga0213922_1005194 | Not Available | 3993 | Open in IMG/M |
3300021961|Ga0222714_10019215 | Not Available | 5406 | Open in IMG/M |
3300021962|Ga0222713_10135009 | All Organisms → Viruses → Predicted Viral | 1723 | Open in IMG/M |
3300021962|Ga0222713_10225279 | All Organisms → Viruses → Predicted Viral | 1237 | Open in IMG/M |
3300021962|Ga0222713_10261751 | All Organisms → Viruses → Predicted Viral | 1121 | Open in IMG/M |
3300021962|Ga0222713_10350408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
3300021962|Ga0222713_10429072 | Not Available | 807 | Open in IMG/M |
3300021963|Ga0222712_10000949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 37079 | Open in IMG/M |
3300021963|Ga0222712_10139841 | Not Available | 1646 | Open in IMG/M |
3300021963|Ga0222712_10211693 | Not Available | 1262 | Open in IMG/M |
3300021963|Ga0222712_10475517 | Not Available | 744 | Open in IMG/M |
3300022176|Ga0212031_1001801 | All Organisms → Viruses → Predicted Viral | 2204 | Open in IMG/M |
3300022179|Ga0181353_1028721 | Not Available | 1474 | Open in IMG/M |
3300022190|Ga0181354_1123501 | Not Available | 830 | Open in IMG/M |
3300022198|Ga0196905_1026106 | All Organisms → Viruses → Predicted Viral | 1788 | Open in IMG/M |
3300022747|Ga0228703_1078449 | Not Available | 812 | Open in IMG/M |
3300022752|Ga0214917_10008471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10092 | Open in IMG/M |
3300022752|Ga0214917_10017597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6047 | Open in IMG/M |
3300022752|Ga0214917_10038868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3413 | Open in IMG/M |
3300022752|Ga0214917_10058360 | All Organisms → Viruses → Predicted Viral | 2536 | Open in IMG/M |
3300022752|Ga0214917_10066646 | Not Available | 2296 | Open in IMG/M |
3300022752|Ga0214917_10322768 | Not Available | 674 | Open in IMG/M |
3300023174|Ga0214921_10046893 | All Organisms → Viruses → Predicted Viral | 3873 | Open in IMG/M |
3300023174|Ga0214921_10075000 | All Organisms → Viruses → Predicted Viral | 2724 | Open in IMG/M |
3300023174|Ga0214921_10078421 | All Organisms → Viruses → Predicted Viral | 2633 | Open in IMG/M |
3300023174|Ga0214921_10168400 | Not Available | 1440 | Open in IMG/M |
3300023174|Ga0214921_10192446 | Not Available | 1290 | Open in IMG/M |
3300023174|Ga0214921_10202767 | Not Available | 1236 | Open in IMG/M |
3300023174|Ga0214921_10203604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1232 | Open in IMG/M |
3300023174|Ga0214921_10290329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 920 | Open in IMG/M |
3300023179|Ga0214923_10537449 | Not Available | 566 | Open in IMG/M |
3300023179|Ga0214923_10573141 | Not Available | 539 | Open in IMG/M |
3300027114|Ga0208009_1007536 | All Organisms → Viruses → Predicted Viral | 2790 | Open in IMG/M |
3300027608|Ga0208974_1019641 | All Organisms → Viruses → Predicted Viral | 2111 | Open in IMG/M |
3300027659|Ga0208975_1004613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5131 | Open in IMG/M |
3300027734|Ga0209087_1000181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40326 | Open in IMG/M |
3300027734|Ga0209087_1108942 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
3300027734|Ga0209087_1163645 | Not Available | 883 | Open in IMG/M |
3300027736|Ga0209190_1252747 | Not Available | 696 | Open in IMG/M |
3300027741|Ga0209085_1329985 | Not Available | 571 | Open in IMG/M |
3300027754|Ga0209596_1377123 | Not Available | 539 | Open in IMG/M |
3300027759|Ga0209296_1008677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6225 | Open in IMG/M |
3300027759|Ga0209296_1037809 | All Organisms → Viruses → Predicted Viral | 2605 | Open in IMG/M |
3300027759|Ga0209296_1042652 | All Organisms → Viruses → Predicted Viral | 2415 | Open in IMG/M |
3300027759|Ga0209296_1103652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1353 | Open in IMG/M |
3300027759|Ga0209296_1281832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
3300027785|Ga0209246_10035120 | Not Available | 1914 | Open in IMG/M |
3300027793|Ga0209972_10042464 | All Organisms → cellular organisms → Bacteria | 2534 | Open in IMG/M |
3300027816|Ga0209990_10102833 | Not Available | 1385 | Open in IMG/M |
3300027816|Ga0209990_10393302 | Not Available | 604 | Open in IMG/M |
3300027816|Ga0209990_10426293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300027963|Ga0209400_1138270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1077 | Open in IMG/M |
3300027973|Ga0209298_10000172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 39944 | Open in IMG/M |
3300028025|Ga0247723_1000192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39331 | Open in IMG/M |
3300028025|Ga0247723_1000208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37808 | Open in IMG/M |
3300028025|Ga0247723_1000600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 24060 | Open in IMG/M |
3300028025|Ga0247723_1001382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14312 | Open in IMG/M |
3300028025|Ga0247723_1002622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9432 | Open in IMG/M |
3300028025|Ga0247723_1009927 | All Organisms → Viruses → Predicted Viral | 3768 | Open in IMG/M |
3300028025|Ga0247723_1031916 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
3300028025|Ga0247723_1051615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
3300028025|Ga0247723_1142681 | All Organisms → Viruses | 567 | Open in IMG/M |
3300029933|Ga0119945_1029789 | All Organisms → Viruses | 622 | Open in IMG/M |
3300031758|Ga0315907_10000939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39865 | Open in IMG/M |
3300031758|Ga0315907_10001800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28360 | Open in IMG/M |
3300031758|Ga0315907_10060266 | All Organisms → Viruses → Predicted Viral | 3310 | Open in IMG/M |
3300031758|Ga0315907_10132832 | All Organisms → Viruses → Predicted Viral | 2117 | Open in IMG/M |
3300031758|Ga0315907_10155958 | All Organisms → Viruses → Predicted Viral | 1931 | Open in IMG/M |
3300031758|Ga0315907_10296201 | Not Available | 1329 | Open in IMG/M |
3300031758|Ga0315907_10317162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1276 | Open in IMG/M |
3300031758|Ga0315907_10338488 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
3300031758|Ga0315907_10430373 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
3300031758|Ga0315907_10431853 | Not Available | 1055 | Open in IMG/M |
3300031758|Ga0315907_10682010 | Not Available | 784 | Open in IMG/M |
3300031758|Ga0315907_10691209 | Not Available | 777 | Open in IMG/M |
3300031758|Ga0315907_11117854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 558 | Open in IMG/M |
3300031758|Ga0315907_11288755 | Not Available | 505 | Open in IMG/M |
3300031784|Ga0315899_10126645 | All Organisms → Viruses | 2617 | Open in IMG/M |
3300031784|Ga0315899_10245077 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
3300031787|Ga0315900_10370524 | Not Available | 1146 | Open in IMG/M |
3300031787|Ga0315900_10826405 | Not Available | 634 | Open in IMG/M |
3300031857|Ga0315909_10002229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25135 | Open in IMG/M |
3300031857|Ga0315909_10066857 | All Organisms → Viruses → Predicted Viral | 3235 | Open in IMG/M |
3300031857|Ga0315909_10139466 | All Organisms → Viruses → Predicted Viral | 2017 | Open in IMG/M |
3300031857|Ga0315909_10269403 | Not Available | 1293 | Open in IMG/M |
3300031857|Ga0315909_10420464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 950 | Open in IMG/M |
3300031857|Ga0315909_10437447 | All Organisms → Viruses | 924 | Open in IMG/M |
3300031857|Ga0315909_10474104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300031857|Ga0315909_10541868 | Not Available | 792 | Open in IMG/M |
3300031857|Ga0315909_10945527 | Not Available | 526 | Open in IMG/M |
3300031951|Ga0315904_10002449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28740 | Open in IMG/M |
3300031951|Ga0315904_10206100 | All Organisms → Viruses → Predicted Viral | 1925 | Open in IMG/M |
3300031951|Ga0315904_10496641 | Not Available | 1077 | Open in IMG/M |
3300031951|Ga0315904_10750996 | Not Available | 811 | Open in IMG/M |
3300031951|Ga0315904_11241983 | Not Available | 568 | Open in IMG/M |
3300031963|Ga0315901_10263954 | Not Available | 1448 | Open in IMG/M |
3300031963|Ga0315901_10484657 | Not Available | 968 | Open in IMG/M |
3300031963|Ga0315901_10615554 | All Organisms → Viruses | 821 | Open in IMG/M |
3300031963|Ga0315901_10647376 | Not Available | 793 | Open in IMG/M |
3300031963|Ga0315901_10894591 | Not Available | 632 | Open in IMG/M |
3300031963|Ga0315901_11039924 | Not Available | 568 | Open in IMG/M |
3300032050|Ga0315906_10174840 | All Organisms → Viruses → Predicted Viral | 2049 | Open in IMG/M |
3300032050|Ga0315906_11061399 | Not Available | 602 | Open in IMG/M |
3300032092|Ga0315905_10002556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19137 | Open in IMG/M |
3300032116|Ga0315903_10977080 | Not Available | 595 | Open in IMG/M |
3300032116|Ga0315903_11138217 | Not Available | 532 | Open in IMG/M |
3300033996|Ga0334979_0000271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40776 | Open in IMG/M |
3300034012|Ga0334986_0168207 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
3300034012|Ga0334986_0559458 | Not Available | 551 | Open in IMG/M |
3300034061|Ga0334987_0201499 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
3300034061|Ga0334987_0383766 | Not Available | 896 | Open in IMG/M |
3300034061|Ga0334987_0581351 | Not Available | 665 | Open in IMG/M |
3300034062|Ga0334995_0012809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7773 | Open in IMG/M |
3300034062|Ga0334995_0167730 | All Organisms → Viruses → Predicted Viral | 1565 | Open in IMG/M |
3300034062|Ga0334995_0604755 | All Organisms → Viruses | 636 | Open in IMG/M |
3300034063|Ga0335000_0738921 | Not Available | 536 | Open in IMG/M |
3300034101|Ga0335027_0283994 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
3300034103|Ga0335030_0734417 | Not Available | 588 | Open in IMG/M |
3300034104|Ga0335031_0675344 | Not Available | 597 | Open in IMG/M |
3300034106|Ga0335036_0380738 | Not Available | 912 | Open in IMG/M |
3300034116|Ga0335068_0292419 | Not Available | 815 | Open in IMG/M |
3300034117|Ga0335033_0601823 | Not Available | 512 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 16.67% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 14.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.24% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.19% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.15% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.21% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.17% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.47% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.47% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.12% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.39% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.39% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.69% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.69% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.69% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.35% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.35% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.35% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.35% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.35% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.35% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.35% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.35% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM37_10339064 | 3300001850 | Marine Plankton | MSSGQHKKHIKFNKSIVRDGVIVILNKNGTEKHRLDPKTKEFITKK* |
B570J29599_10018494 | 3300002298 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKEVTKGGK* |
B570J29032_1091957684 | 3300002408 | Freshwater | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLD |
B570J40625_1003613266 | 3300002835 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEVIKGK* |
JGI25908J49247_100349142 | 3300003277 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGSEKVRLDPKAKQTIKGSK* |
JGI25907J50239_10417073 | 3300003394 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMVVILRKDGSEKVRLDPKAKQTIKGSK* |
JGI25930J51415_10290691 | 3300003499 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVIKGSK*KIQD* |
Ga0007787_103656381 | 3300004240 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGTEKVRLDPKTKEVIKGSK*KI |
Ga0007764_110084772 | 3300004797 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGSK* |
Ga0068876_100628625 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLDPKTKEQIKGSK* |
Ga0068876_100652644 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKLRLDPKTKELIKGSK* |
Ga0068876_100877397 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIIRDGVIVILRKDGSEKVRLDPKTKEVIKGSK* |
Ga0068876_101001554 | 3300005527 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEQVKGSK* |
Ga0068876_101252866 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIIRDGVIVILRKDGSEKVRLDPKTKEVIKGTK* |
Ga0068876_101637963 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGVVVILRKDGTEKVRLDPKTKEILKGSK* |
Ga0068876_102113665 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIIRDGVIVILRKDGTEKVRLDPKTKETIKGTK* |
Ga0068876_102345111 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMIVILRKDGTEKVRLDPKTKETIKGTK* |
Ga0068876_105016134 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKIRLDPKTKETIKGTK* |
Ga0068876_105853122 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKETIKGNK* |
Ga0068876_106093333 | 3300005527 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGVIVILRKDGSEKVRLDPKTKEVVKGSK* |
Ga0068872_102118662 | 3300005528 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKETIKGTK* |
Ga0068872_104823143 | 3300005528 | Freshwater Lake | MSSGQRKRHDGWNKSIIRDGVIVILRKDGSEKVRLDPKTKEVIKG |
Ga0049081_1000081815 | 3300005581 | Freshwater Lentic | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRIDPKTKEIIKGGK* |
Ga0049081_100184522 | 3300005581 | Freshwater Lentic | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKEVIKGSK* |
Ga0049081_100892773 | 3300005581 | Freshwater Lentic | MSSGQRKRHDGWNKSIMRDGMIVILRKDGREKIRLDPKTKEIIKGSK* |
Ga0078894_116434402 | 3300005662 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEPSKGIK* |
Ga0078894_116942542 | 3300005662 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPKTKEVIKGSK* |
Ga0076948_11152315 | 3300005739 | Lake Water | HDGFNKSIMRDGVIVILRKDGREKERLDPKTKERIKGSK* |
Ga0079957_10329977 | 3300005805 | Lake | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQIKGTK* |
Ga0079957_10366354 | 3300005805 | Lake | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGK* |
Ga0075464_106683572 | 3300006805 | Aqueous | MSSGQRKRHDGFNKSIMRDGLIVILRKDGREKTRLDPKTKEPNKGTK* |
Ga0075464_107117683 | 3300006805 | Aqueous | MSSGQRKRHDGFNKSIIRDGVIVILRKNGSEKVRLDPKTKEVIKGDK* |
Ga0075464_110323312 | 3300006805 | Aqueous | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTRETIKGNK* |
Ga0103959_10873917 | 3300007214 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKDGREKERLDPKTKERIKGSK* |
Ga0099851_10249663 | 3300007538 | Aqueous | MSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQIKGSK* |
Ga0099851_11604652 | 3300007538 | Aqueous | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQIKGSK* |
Ga0099848_10324541 | 3300007541 | Aqueous | MSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQIKG |
Ga0099848_10466541 | 3300007541 | Aqueous | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLDPKTKEQIKGSKWKTQ |
Ga0099848_11227612 | 3300007541 | Aqueous | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQIKGSKWKTQD* |
Ga0104986_160033 | 3300007734 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKEVVKGR* |
Ga0104988_1030914 | 3300007735 | Freshwater | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPRTKEVLKGSK* |
Ga0104988_1093058 | 3300007735 | Freshwater | MSSGQRKRHDGFNKSIMRDGVVVILRKDGREKVRLDPKTKETIKGSK* |
Ga0099850_12629841 | 3300007960 | Aqueous | GQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQIKGSK* |
Ga0110929_101195810 | 3300008072 | Water Bodies | MSGGQRKRHDGFNKSIIRDGVIVILRKDGRERMRLDRKTKQPIKGNK* |
Ga0114340_100230312 | 3300008107 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPKIKQENKLKRKASKWQ* |
Ga0114340_10303004 | 3300008107 | Freshwater, Plankton | MSSGQRKRHDGFNKSIIKDGLVVILRKDGTEKVRLDPKTKEVVKGSK* |
Ga0114340_10330667 | 3300008107 | Freshwater, Plankton | MSSGQRKRHDGWNKSIIRDGVVVILRKDGTEKVRLDPKTKEVIKGNK* |
Ga0114340_10691414 | 3300008107 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVVVILRKDGTEKVRLDPRTKEVIKGSK* |
Ga0114340_11226665 | 3300008107 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGIK* |
Ga0114340_11644723 | 3300008107 | Freshwater, Plankton | MSSGQRKRHDGFNKSIMRDGVIVILRKNGTEKVRLDPKTKETIKGTK* |
Ga0114340_12528483 | 3300008107 | Freshwater, Plankton | HDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGK* |
Ga0114340_12654622 | 3300008107 | Freshwater, Plankton | MSSGQRKRHDGFNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGK* |
Ga0114341_101564104 | 3300008108 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPKTKETIKGTK* |
Ga0114341_102984414 | 3300008108 | Freshwater, Plankton | FNKSIMRDGMIVILRKDGREKTRLDPKTKEQVKGSK* |
Ga0114341_104167104 | 3300008108 | Freshwater, Plankton | WNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGSK* |
Ga0114343_10571314 | 3300008110 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVVVILRKDGAEKVRLDPKTKETIKGTK* |
Ga0114343_10581024 | 3300008110 | Freshwater, Plankton | MSSGQRKRHDGWNKSIIRDGVIVILRKDGSEKVRLDPKTKEVIRGSK* |
Ga0114343_11420651 | 3300008110 | Freshwater, Plankton | WNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGIK* |
Ga0114343_12061363 | 3300008110 | Freshwater, Plankton | RKIMSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLYPKTKEVIKRSK* |
Ga0114346_11697811 | 3300008113 | Freshwater, Plankton | IMSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGK* |
Ga0114347_100303015 | 3300008114 | Freshwater, Plankton | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEQVKGIK* |
Ga0114347_10031638 | 3300008114 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPKTKETLKGSK* |
Ga0114347_10098606 | 3300008114 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQLKGTK* |
Ga0114347_11097661 | 3300008114 | Freshwater, Plankton | IMSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGIK* |
Ga0114347_11348055 | 3300008114 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLD |
Ga0114347_11598863 | 3300008114 | Freshwater, Plankton | SGQRKRHDGFNKSIIRDGMIVILRKDGSEKTRFDPKTKEQVKGSK* |
Ga0114350_10080598 | 3300008116 | Freshwater, Plankton | MSSGQRKRHDGWNKSIIRDGLVVILRKDGTEKVRLDPKTKEVIKGNK* |
Ga0114350_10355924 | 3300008116 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEVIKGDK* |
Ga0114350_10388592 | 3300008116 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEVIKGSK* |
Ga0114350_10879141 | 3300008116 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQIKGNK* |
Ga0114350_11382654 | 3300008116 | Freshwater, Plankton | SSGQRKRHDGFNKSIMRDGVIVILRKNGTEKVRLDPKTKETIKGTK* |
Ga0114350_11451072 | 3300008116 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQIKGNK* |
Ga0114350_11701401 | 3300008116 | Freshwater, Plankton | MSSGQRNRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGSK* |
Ga0114350_11965003 | 3300008116 | Freshwater, Plankton | GYEKSRTRKIMSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGK* |
Ga0114351_12258121 | 3300008117 | Freshwater, Plankton | HDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGIK* |
Ga0114351_13663434 | 3300008117 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPK |
Ga0114351_14147493 | 3300008117 | Freshwater, Plankton | QRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVIKGSK* |
Ga0114354_10011669 | 3300008119 | Freshwater, Plankton | MSSGQRKRHDGFNKSIIRDGMIVILRKDGREKTRLDPKTKEPSKGIK* |
Ga0114355_10791953 | 3300008120 | Freshwater, Plankton | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLDPKTKERIKGSK* |
Ga0114841_100114118 | 3300008259 | Freshwater, Plankton | MSSGQRKRHDGFNKSIIRDGMIVILRKDGSEKTRFDPKTKKIVKGSK* |
Ga0114337_11737994 | 3300008262 | Freshwater, Plankton | IMSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGSK* |
Ga0114349_11042625 | 3300008263 | Freshwater, Plankton | HDGWNKSIMRDGMIVILRKDGTEKVRLDPKTKETIKGTK* |
Ga0114353_13273581 | 3300008264 | Freshwater, Plankton | MSSGQRKRYDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVIKGSK* |
Ga0114361_10404005 | 3300008265 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVIVILRKDGSEKVRLDPKTKETIKGTK* |
Ga0114363_10081238 | 3300008266 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPRTKEVIKGNK* |
Ga0114363_10416132 | 3300008266 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEIIKGTK* |
Ga0114363_11013654 | 3300008266 | Freshwater, Plankton | MSSGQRKRHDGFNKSIMRDGMIVILRKDGSEKTRFDPKTKKIVKGSK* |
Ga0114363_11115032 | 3300008266 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVIVILRKDGSEKVRLDPKTKEVTKGGK* |
Ga0114363_11130831 | 3300008266 | Freshwater, Plankton | HDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEQVKGSK* |
Ga0114363_11296763 | 3300008266 | Freshwater, Plankton | MSSGQRKRHDGFNKSIMRDGMVVILRKDGREKTRLDPKTKEQIKGSK* |
Ga0114363_11618334 | 3300008266 | Freshwater, Plankton | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRIDPKTKEIIKGG |
Ga0114363_11912721 | 3300008266 | Freshwater, Plankton | HDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEQVKGIK* |
Ga0114878_11270411 | 3300008339 | Freshwater Lake | SGQRKRHDGFNKSIIRDGMIVILRKDGSEKTRFDPKTKKIVKGSK* |
Ga0114876_11246894 | 3300008448 | Freshwater Lake | SSGQRKRHDGWNKSIMRDGVIVILRKDGSEKVRLDPKTKEVVKGSK* |
Ga0114876_11657861 | 3300008448 | Freshwater Lake | KRHDGWNKSIIRDGVIVILRKDGSEKVRLDPKTKEVIKGSK* |
Ga0114876_12197124 | 3300008448 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGVIVILRKDGSEKVRLDPK |
Ga0114880_10522834 | 3300008450 | Freshwater Lake | MSSGQRKRHDGWNKSIIRDGVVVILRKDGTEKVRLDPRTKEVIKGSK* |
Ga0114880_10578635 | 3300008450 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQIKGAK* |
Ga0114880_11279743 | 3300008450 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKETVKGAK* |
Ga0114880_11317124 | 3300008450 | Freshwater Lake | MSSGQRKRHDGFNKSIIRDGMIVILRKDGSEKTRFDPKTK |
Ga0114880_12790771 | 3300008450 | Freshwater Lake | DGWNKSIIRDGVIVILRKDGREKMRLDPKTKEQIKGSK* |
Ga0105103_105565372 | 3300009085 | Freshwater Sediment | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLDPKTKEVIKGK* |
Ga0114962_101289843 | 3300009151 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGSEKTRLDPKTREVIKGSK* |
Ga0114980_1000022549 | 3300009152 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEIIKGSK* |
Ga0114980_106249262 | 3300009152 | Freshwater Lake | MSSGQRKRHDGFNKSIMRNGMVVILRKDGREKERLDPKTKEQIKGSK* |
Ga0114963_101912102 | 3300009154 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGSEKTRIDPKTRQVIKGDR* |
Ga0114968_100608864 | 3300009155 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGSEKTRIDPKTRQVIKGDK* |
Ga0114968_101328816 | 3300009155 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKDGREKTRLDPKTKEQIKGTK* |
Ga0114968_102175474 | 3300009155 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEPNKGTK* |
Ga0114977_100998213 | 3300009158 | Freshwater Lake | MSSGQHKRHDGFNKTIMRDGMIVILRKDGREKTRLDPKTKEPNKVTQ* |
Ga0114978_100417446 | 3300009159 | Freshwater Lake | MSSGQRKRHDGFNKSIMRNGMVVILRKDGREKERLDPKTKEHIKGSK* |
Ga0114981_104496592 | 3300009160 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGSEKVRLDPKTKEVIKGDK* |
Ga0114966_101736793 | 3300009161 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGTEKTRIDPKKKEIIRGSK* |
Ga0105102_108372203 | 3300009165 | Freshwater Sediment | KVMSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEVIKGKK* |
Ga0114979_105580803 | 3300009180 | Freshwater Lake | MSSGQRKRHDGFNKSIIRDGMIVILRKDGSEKTRFDPKTKEPSKGTK* |
Ga0114974_100066801 | 3300009183 | Freshwater Lake | MEVMSSGQRKTHDGWNTSIMRDGMIVILRKDGREKERLDPKTKEAIKGSK* |
Ga0114974_100247787 | 3300009183 | Freshwater Lake | MSSGQRKRHDGFNKSIIRDGVIVILRKNGSEKTRLDPKTKEVIKGTK* |
Ga0114974_101346834 | 3300009183 | Freshwater Lake | MSSGQRKRHDGFNKSIIRDGMIVILRKDGREKTRLDPKAKELTKGSK* |
Ga0114974_103411474 | 3300009183 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMVVILRKDGSEKVRLDPKTKEIIKGDK* |
Ga0114976_101054375 | 3300009184 | Freshwater Lake | MSSGQRKRHDGFNKTIMRDGMIVILRKDGREKTRLDPKTKEPNKGTK* |
Ga0114976_101186235 | 3300009184 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKAKELTKGTK* |
Ga0114976_101645285 | 3300009184 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKAKELTKGSK* |
Ga0114976_107174762 | 3300009184 | Freshwater Lake | MSSGQGQRHDGFNKSIMRDGVIVILRKNGTEKTRLDPKTKEVIKGSK* |
Ga0103858_100237745 | 3300009239 | River Water | MSSGQRQRHDKFNKSIIRDGVIVILRKDGRERMRLDRKTKQPIKGTKNG* |
Ga0129333_101823054 | 3300010354 | Freshwater To Marine Saline Gradient | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQLKGTK* |
Ga0129333_106602661 | 3300010354 | Freshwater To Marine Saline Gradient | SGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEVIKGK* |
Ga0129333_115677001 | 3300010354 | Freshwater To Marine Saline Gradient | KRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGK* |
Ga0129336_102126951 | 3300010370 | Freshwater To Marine Saline Gradient | MSSGQRKRHDGFNKSIIRDGVIVILRKNGTEKVRLDPKTKEVIKGSK* |
Ga0133913_116147734 | 3300010885 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMIVILRKDGREKERLDPKTKEAIKGSK* |
Ga0133913_134213261 | 3300010885 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEQIKGSK* |
Ga0151517_108144 | 3300011113 | Freshwater | MSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEVIKGSK* |
Ga0151516_1052916 | 3300011116 | Freshwater | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPKTKEVLKGSK* |
Ga0102688_16015992 | 3300011381 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGVIVILRKDGSEKVRLDPKTKEVIKGNK* |
Ga0119955_10045216 | 3300012006 | Freshwater | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEIIKGK* |
Ga0119955_11038783 | 3300012006 | Freshwater | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKETIKGSK* |
Ga0157606_10472081 | 3300012733 | Freshwater | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRFD |
Ga0129338_14685833 | 3300012970 | Aqueous | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQLK |
Ga0164293_1000107915 | 3300013004 | Freshwater | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRFDPKTKKEIKGQK* |
Ga0164292_106386291 | 3300013005 | Freshwater | KEEVMSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLDPKTKEVIKGK* |
Ga0164292_106992583 | 3300013005 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTREQIKGTK* |
Ga0164295_101906861 | 3300013014 | Freshwater | GQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEPSKGIK* |
(restricted) Ga0172367_101878894 | 3300013126 | Freshwater | VSSGQQKRHDGWNKSIIRDGVVVILRKDGREKMRLDPKTKEVIKGSK* |
(restricted) Ga0172367_101970425 | 3300013126 | Freshwater | MSSGKRKPHYGFNKSIIRDGVVVILDKNGKVREYLDPKT |
(restricted) Ga0172373_100657164 | 3300013131 | Freshwater | MSSGKRKPHYGFNKSIIRDGVVVILDKNGKVREYLDPKTKEVIKK* |
Ga0177922_100260492 | 3300013372 | Freshwater | MSSGQRKRHDGWHKSIMRDGMIVILRKDGSEKVRLDPKTKETIKGTK* |
Ga0177922_103149214 | 3300013372 | Freshwater | MSSGQRKRHDGWNKSIMRDGVVVILRKDGTEKVRLDPKTKEVVKGIK* |
Ga0177922_104067414 | 3300013372 | Freshwater | MSSGQRKRHDGWNKSIIRDGMVVILRKDGSEKVRLDPKAKEIIKGSK* |
Ga0177922_106021814 | 3300013372 | Freshwater | MSSGQRKRHDGWNKSIMRDGMVVILRKDGSEKVRLDLKAKEVIKGNK* |
Ga0119954_10040338 | 3300014819 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKEVIKGSK* |
Ga0134315_10653654 | 3300014962 | Surface Water | MSSGQRQIKRPFNKSIMRDGLVVILRKDGRVKAYKDPKTGDVIKDKK* |
Ga0181364_10599202 | 3300017701 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKEIIKGSK |
Ga0181352_10906292 | 3300017747 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGTEKVRLDPKTKEVVKGSK |
Ga0181356_12344382 | 3300017761 | Freshwater Lake | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRD |
Ga0181355_12589421 | 3300017785 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKEAIKGTR |
Ga0169931_105406772 | 3300017788 | Freshwater | MSSGKRKPHYGFNKSIIRNGVVVILDKNGKVREYLDPKTKEVIKK |
Ga0181359_10070208 | 3300019784 | Freshwater Lake | MSSGQRKRHDGFNKSIIRDGLIVILRKDGREKTRLDPKTKEQIKGTK |
Ga0181359_10973741 | 3300019784 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGTEKVRLDPKTKEVIKGSK |
Ga0181359_11486143 | 3300019784 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKEVIKGSK |
Ga0181359_11666244 | 3300019784 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKE |
Ga0181359_11899871 | 3300019784 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGSEKVRLDPKAI |
Ga0181359_12036011 | 3300019784 | Freshwater Lake | LMSSGQRKRHDGFNKSIMRDGMIVILRKDGSEKVRLDPKAKQTIKGSK |
Ga0211736_100404802 | 3300020151 | Freshwater | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEPTKGSK |
Ga0211734_108542772 | 3300020159 | Freshwater | MSSGQRKRHDGFNQSIIRDGVIVILRKNGTEKTRLDPKTKEVIKGSK |
Ga0211733_104545652 | 3300020160 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKEPTKGSK |
Ga0208050_10067185 | 3300020498 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKLRLDPKTKELIKGSK |
Ga0208364_100004431 | 3300020533 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKEVTKGGK |
Ga0213922_10051943 | 3300021956 | Freshwater | MSSGKRRPHYGFNKSIIRDGVVVILDKNGKIREYLDPKTKEVIKK |
Ga0222714_100192153 | 3300021961 | Estuarine Water | MSSGQRKRHDGFNKSIMRDGMVVILRKDGREKTRLDPKTKEQIKGSK |
Ga0222713_101350096 | 3300021962 | Estuarine Water | KVMSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPRTKEILKGSK |
Ga0222713_102252795 | 3300021962 | Estuarine Water | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKETIKGTK |
Ga0222713_102617511 | 3300021962 | Estuarine Water | GWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGK |
Ga0222713_103504081 | 3300021962 | Estuarine Water | SKIMSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEVIKGKK |
Ga0222713_104290724 | 3300021962 | Estuarine Water | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKEVVKGR |
Ga0222712_1000094956 | 3300021963 | Estuarine Water | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEQIKGSK |
Ga0222712_101398416 | 3300021963 | Estuarine Water | MSSGQRKRHDGWNKSIIRDGVVVILRKDGSEKVRLDPKTKEVIKGDK |
Ga0222712_102116932 | 3300021963 | Estuarine Water | MSSGQHKRHDGFNKSIIRNGLVVILRKDGSVKVRLDPKTKEVVKDKK |
Ga0222712_104755173 | 3300021963 | Estuarine Water | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEVIKGKK |
Ga0212031_10018013 | 3300022176 | Aqueous | MSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQIKGSK |
Ga0181353_10287214 | 3300022179 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKVRLDPKTKEITKGK |
Ga0181354_11235012 | 3300022190 | Freshwater Lake | MSSGQRKRHDGWNKLIMRDGLIVILRKDGSEKVRLDPKTKEVIKGSK |
Ga0196905_10261062 | 3300022198 | Aqueous | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQIKGSKWKTQD |
Ga0228703_10784494 | 3300022747 | Freshwater | MSSGQHKRHDGFNKSIIRNGLIVILRKDGSVKVRLDPKTKEVVKDKK |
Ga0214917_1000847111 | 3300022752 | Freshwater | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLDPKTKERIKGSK |
Ga0214917_100175977 | 3300022752 | Freshwater | MSSGQRKRHDGFNKSIMRDGVIVILRKNGTEKTRLDPKTKEVIKGDK |
Ga0214917_100388686 | 3300022752 | Freshwater | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKETIKGSK |
Ga0214917_100583601 | 3300022752 | Freshwater | RHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKERIKGSK |
Ga0214917_100666465 | 3300022752 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKERIKGSK |
Ga0214917_103227682 | 3300022752 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKEVIKGSK |
Ga0214921_100468936 | 3300023174 | Freshwater | MSSGQRKRHDGFNKSIMRDGVIVILRKDGREKTRLDPKTKELTKGSK |
Ga0214921_100750006 | 3300023174 | Freshwater | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGIK |
Ga0214921_100784218 | 3300023174 | Freshwater | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEQIKGTK |
Ga0214921_101684005 | 3300023174 | Freshwater | MSSGQRKRHDGFNKSIMRDGVIVILRKNGSEKTRIDPKTRQVIKGDK |
Ga0214921_101924462 | 3300023174 | Freshwater | MSSGQRKRHDGFNKSIIRDGMIVILRKDGREKTRLDPKTKEQIKGTK |
Ga0214921_102027674 | 3300023174 | Freshwater | MSSGQRKRHDGFNKSIMRDGVIVILRKNGSEKTRLDPKTKEVIKGNK |
Ga0214921_102036046 | 3300023174 | Freshwater | MSSGQRKRHDGFNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGSK |
Ga0214921_102903294 | 3300023174 | Freshwater | MSSGQRKRHDGFNKSIIRDGVIVILRKNGSEKTRLDPKTKEVIKGIK |
Ga0214923_105374492 | 3300023179 | Freshwater | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLDPKTKEQLKGTK |
Ga0214923_105731413 | 3300023179 | Freshwater | SGQRKRHDGWNKSIMRDGVIVILRKDGSEKVRLDPKTKEVVKGSK |
Ga0208009_10075366 | 3300027114 | Deep Subsurface | MSSGQRKRHDGFNKSIIRDGLVVILRKDGTEKVRLDPKTKEVVKGK |
Ga0208974_10196416 | 3300027608 | Freshwater Lentic | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRIDPKTKEIIKGGK |
Ga0208975_10046134 | 3300027659 | Freshwater Lentic | MSSGQRKRHDGWNKSIMRDGMIVILRKDGREKIRLDPKTKEIIKGSK |
Ga0209087_100018115 | 3300027734 | Freshwater Lake | MSSGQRKRHDGFNKTIMRDGMIVILRKDGREKTRLDPKTKEPNKGTK |
Ga0209087_11089425 | 3300027734 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKAKELTKGTK |
Ga0209087_11636453 | 3300027734 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKAKELTKGSK |
Ga0209190_12527472 | 3300027736 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEPSKGIK |
Ga0209085_13299851 | 3300027741 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGSEKTRLDPKT |
Ga0209596_13771233 | 3300027754 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKDGREKTRLDPKTKEQIKGTK |
Ga0209296_10086773 | 3300027759 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMIVILRKDGREKERLDPKTKEAIKGSK |
Ga0209296_10378096 | 3300027759 | Freshwater Lake | GQRKRHDGWNKSIMRDGMVVILRKDGSEKVRLDPKTKEIIKGDK |
Ga0209296_10426527 | 3300027759 | Freshwater Lake | MSSGQRKRHDGFNKSIIRDGMIVILRKDGREKTRLDPKAKELTKGSK |
Ga0209296_11036526 | 3300027759 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGVIVILRKNGSEKVRLDPKTKEVIKGDK |
Ga0209296_12818323 | 3300027759 | Freshwater Lake | MSSGQRKRHDGFNKSIIRDGVIVILRKNGSEKTRLDPKTKEVIKGTK |
Ga0209246_100351204 | 3300027785 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMVVILRKDGSEKVRLDPKAKQTIKGSK |
Ga0209972_100424645 | 3300027793 | Freshwater Lake | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLDPKTKEQIKGSK |
Ga0209990_101028332 | 3300027816 | Freshwater Lake | MSSGQRKRHDGWNKSIIRDGVIVILRKDGSEKVRLDPKTKEVIKGTK |
Ga0209990_103933022 | 3300027816 | Freshwater Lake | MKKIWHAEEFTKIMSSGQRKRHDGWNKSIIRDGVVVILRKDGTEKVRLDPKTKEVIKGNK |
Ga0209990_104262931 | 3300027816 | Freshwater Lake | FNKSIMRDGMIVILRKDGREKTRLDPKTKEQVKGSK |
Ga0209400_11382704 | 3300027963 | Freshwater Lake | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEPNKGTK |
Ga0209298_1000017249 | 3300027973 | Freshwater Lake | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEIIKGSK |
Ga0247723_100019216 | 3300028025 | Deep Subsurface Sediment | MSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQLKGTK |
Ga0247723_100020815 | 3300028025 | Deep Subsurface Sediment | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPRTKEILKGSK |
Ga0247723_100060013 | 3300028025 | Deep Subsurface Sediment | MSSGQRKRHDGWNKSIMRDGMVVILRKDGSEKVRLDPKTKEVIKESK |
Ga0247723_100138215 | 3300028025 | Deep Subsurface Sediment | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKVRLDPKTKEQIKGSK |
Ga0247723_100262216 | 3300028025 | Deep Subsurface Sediment | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKEAIKGTK |
Ga0247723_10099271 | 3300028025 | Deep Subsurface Sediment | IMSSGQRKRHDGFNKSIMRDGVIVILRKDGREKTRLDPKTKEQIKGTK |
Ga0247723_10319162 | 3300028025 | Deep Subsurface Sediment | MSSGQRKRHDGFNKSIIRNGMIVILRKDGREKTRLDPKTKEVIKGK |
Ga0247723_10516152 | 3300028025 | Deep Subsurface Sediment | MSSGQRKRHDGFNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGK |
Ga0247723_11426812 | 3300028025 | Deep Subsurface Sediment | MSSGQRKRHDGWNKSIMRDGMIVILRKDGREKVRLDPKTKEAIKGSK |
Ga0119945_10297892 | 3300029933 | Aquatic | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPRTKEIIKGSK |
Ga0315907_1000093957 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIIRDGLVVILRKDGTEKVRLDPKTKEVIKGNK |
Ga0315907_1000180052 | 3300031758 | Freshwater | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEQVKGIK |
Ga0315907_100602667 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEVIKGDK |
Ga0315907_101328325 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPKTKETLKGSK |
Ga0315907_101559582 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEIIKGTK |
Ga0315907_102962014 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQIKGSK |
Ga0315907_103171625 | 3300031758 | Freshwater | MSSGQRKRHDGFNKSIMRDGMIVILRKDGSEKTRFDPKTKKIVKGSK |
Ga0315907_103384884 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPRTKEVIKGNK |
Ga0315907_104303734 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQIKGNK |
Ga0315907_104318532 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEVIKGSK |
Ga0315907_106820102 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIIRDGVIVILRKDGSEKVRLDPKTKEVIKGSK |
Ga0315907_106912093 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQLKGTK |
Ga0315907_111178543 | 3300031758 | Freshwater | DGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQLKGTK |
Ga0315907_112887552 | 3300031758 | Freshwater | MSSGQRKRHDGWNKSIIRDGVVVILRKDGREKMRLDPKTKEQIKGSK |
Ga0315899_101266456 | 3300031784 | Freshwater | MSSGQRKRHDGWNKSIIRDGVIVILRKDGTEKVRLDPKTKETIKGTK |
Ga0315899_102450775 | 3300031784 | Freshwater | MSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGK |
Ga0315900_103705244 | 3300031787 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTRETIKGNK |
Ga0315900_108264051 | 3300031787 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKIRLDPKTKETIKGTK |
Ga0315909_1000222933 | 3300031857 | Freshwater | MSSGQRKRHDGFNKSIIRDGMIVILRKDGSEKTRFDPKTKKIVKGSK |
Ga0315909_100668574 | 3300031857 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKETIKGNK |
Ga0315909_101394667 | 3300031857 | Freshwater | MKKIWHVEEFTKIMSSGQRKRHDGWNKSIIRDGVVVILRKDGTEKVRLDPRTKEVIKGSK |
Ga0315909_102694034 | 3300031857 | Freshwater | KRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGSK |
Ga0315909_104204645 | 3300031857 | Freshwater | GQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGIK |
Ga0315909_104374475 | 3300031857 | Freshwater | DGWNKSIMRDGVIVILRKDGREKMRLDPKTKEQIKGAK |
Ga0315909_104741041 | 3300031857 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKLRLDPKTKE |
Ga0315909_105418683 | 3300031857 | Freshwater | QRKRHDGFNKSIMRDGVIVILRKNGTEKVRLDPKTKEVIKGSK |
Ga0315909_109455273 | 3300031857 | Freshwater | DGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVIKGSK |
Ga0315904_1000244945 | 3300031951 | Freshwater | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKETIKGTK |
Ga0315904_102061005 | 3300031951 | Freshwater | GQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGSK |
Ga0315904_104966413 | 3300031951 | Freshwater | MSSGQRKRHDGWNKSIMRDGVIVILRKDGSEKVRLDPKTKEVTKGGK |
Ga0315904_107509962 | 3300031951 | Freshwater | MSSGQRKRHDGWNKSIMRDGVVVILRKDGTEKVRLDPRTKEVIKGSK |
Ga0315904_112419831 | 3300031951 | Freshwater | RTRKIMSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVIKGSK |
Ga0315901_102639546 | 3300031963 | Freshwater | MSSGQRKRHDGWNKSIMRDGMIVILRKDGSEKVRLDPKTKEV |
Ga0315901_104846571 | 3300031963 | Freshwater | RKRHDGWNKSIMRDGVVVILRKDGSEKVRLDPKTKEVIKGSK |
Ga0315901_106155544 | 3300031963 | Freshwater | RKIMSSGQRKRHDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGIK |
Ga0315901_106473761 | 3300031963 | Freshwater | CYCPISGWNVKEEKVMSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTRETIKGNK |
Ga0315901_108945911 | 3300031963 | Freshwater | GYEKSRTRKVMSSGQRKRHDGFNKSIMRDGVIVILRKNGTEKVRLDPKTKEVIKGSK |
Ga0315901_110399241 | 3300031963 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKLRLDPKTKETVKGTK |
Ga0315906_101748406 | 3300032050 | Freshwater | MSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQIKGNK |
Ga0315906_110613993 | 3300032050 | Freshwater | KIMSSGQRKRYDGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVIKGSK |
Ga0315905_100025568 | 3300032092 | Freshwater | MSSGQRKRHDGFNKSIIRDGMIVILRKDGREKTRLDPKTKEPSKGIK |
Ga0315903_109770803 | 3300032116 | Freshwater | DGWNKSIMRDGLVVILRKDGTEKVRLDPKTKEVVKGSK |
Ga0315903_111382173 | 3300032116 | Freshwater | KEEVMSSGQRKRHDGWNKSIMRDGVVVILRKDGREKMRLDPKTKEQIKGNK |
Ga0334979_0000271_18616_18759 | 3300033996 | Freshwater | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRFDPKTKKEIKGQK |
Ga0334986_0168207_809_952 | 3300034012 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKELIKGSK |
Ga0334986_0559458_1_123 | 3300034012 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGREKTRLDPKTKE |
Ga0334987_0201499_2_121 | 3300034061 | Freshwater | RHDGWNKSIMRDGVIVILRKDGREKMRLDPKTKEVIKGK |
Ga0334987_0383766_747_896 | 3300034061 | Freshwater | KIMSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKELIKGSK |
Ga0334987_0581351_2_106 | 3300034061 | Freshwater | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRL |
Ga0334995_0012809_1102_1245 | 3300034062 | Freshwater | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKETVKGSK |
Ga0334995_0167730_756_899 | 3300034062 | Freshwater | MSSGQRKRHDGFNKSIMRDGMIVILRKDGREKTRLDPKTKEQVKGGK |
Ga0334995_0604755_159_299 | 3300034062 | Freshwater | MSSGQRKRHDGWNKSIIRDGVIVILRKDGREKMRLDPKTKEVIKGK |
Ga0335000_0738921_3_194 | 3300034063 | Freshwater | SCYCPISGWNVKEEKVMSSGQRKRHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKETIKGNK |
Ga0335027_0283994_796_939 | 3300034101 | Freshwater | MSSGQRKRHDSWNKSIMRDGLIVILRKDGREKTRLDPKTKEQIKGSK |
Ga0335030_0734417_453_587 | 3300034103 | Freshwater | SGQRKRHDGFNKSIIRDGMIVILRKDGREKTRLDPKTKEVIKGK |
Ga0335031_0675344_3_125 | 3300034104 | Freshwater | RHDGWNKSIMRDGVIVILRKDGTEKVRLDPKTKETIKGNK |
Ga0335036_0380738_249_392 | 3300034106 | Freshwater | MSSGQRKRHDGFNKSIIRDGVVVILRKDGREKTRLDPKTKELTKGSK |
Ga0335068_0292419_1_147 | 3300034116 | Freshwater | IMSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKVRLDPKTKELIKGSK |
Ga0335033_0601823_400_510 | 3300034117 | Freshwater | MSSGQRKRHDGWNKSIMRDGLIVILRKDGSEKLRLDP |
⦗Top⦘ |