Basic Information | |
---|---|
Family ID | F011607 |
Family Type | Metagenome |
Number of Sequences | 289 |
Average Sequence Length | 50 residues |
Representative Sequence | MSEEDLELLITMDDPGEDTLEEDTFHLQADNTTARWSGQPQQGGDPTSKQK |
Number of Associated Samples | 190 |
Number of Associated Scaffolds | 289 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 88.85 % |
% of genes near scaffold ends (potentially truncated) | 15.57 % |
% of genes from short scaffolds (< 2000 bps) | 82.35 % |
Associated GOLD sequencing projects | 163 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.24 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.083 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.609 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.907 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (73.010 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.92% β-sheet: 0.00% Coil/Unstructured: 86.08% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 289 Family Scaffolds |
---|---|---|
PF02148 | zf-UBP | 21.80 |
PF07883 | Cupin_2 | 5.54 |
PF12146 | Hydrolase_4 | 4.50 |
PF02518 | HATPase_c | 2.08 |
PF05726 | Pirin_C | 1.38 |
PF12697 | Abhydrolase_6 | 1.38 |
PF00072 | Response_reg | 1.04 |
PF00578 | AhpC-TSA | 1.04 |
PF01966 | HD | 1.04 |
PF00561 | Abhydrolase_1 | 1.04 |
PF00211 | Guanylate_cyc | 0.69 |
PF08447 | PAS_3 | 0.69 |
PF12681 | Glyoxalase_2 | 0.69 |
PF08534 | Redoxin | 0.69 |
PF07978 | NIPSNAP | 0.69 |
PF00903 | Glyoxalase | 0.69 |
PF00581 | Rhodanese | 0.69 |
PF06736 | TMEM175 | 0.69 |
PF13637 | Ank_4 | 0.69 |
PF13185 | GAF_2 | 0.35 |
PF03466 | LysR_substrate | 0.35 |
PF00326 | Peptidase_S9 | 0.35 |
PF13946 | DUF4214 | 0.35 |
PF00690 | Cation_ATPase_N | 0.35 |
PF01625 | PMSR | 0.35 |
PF00512 | HisKA | 0.35 |
PF02321 | OEP | 0.35 |
PF10137 | TIR-like | 0.35 |
PF13460 | NAD_binding_10 | 0.35 |
PF05988 | DUF899 | 0.35 |
PF12706 | Lactamase_B_2 | 0.35 |
PF04264 | YceI | 0.35 |
PF00970 | FAD_binding_6 | 0.35 |
PF12902 | Ferritin-like | 0.35 |
PF00571 | CBS | 0.35 |
PF08281 | Sigma70_r4_2 | 0.35 |
PF13426 | PAS_9 | 0.35 |
PF13857 | Ank_5 | 0.35 |
PF06441 | EHN | 0.35 |
PF02627 | CMD | 0.35 |
PF13191 | AAA_16 | 0.35 |
COG ID | Name | Functional Category | % Frequency in 289 Family Scaffolds |
---|---|---|---|
COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 21.80 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 1.38 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.69 |
COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.69 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.35 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.35 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.35 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.35 |
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.35 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.35 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.08 % |
Unclassified | root | N/A | 15.92 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459015|G14TP7Y01A3D8K | Not Available | 679 | Open in IMG/M |
3300000953|JGI11615J12901_11094011 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300000955|JGI1027J12803_105163235 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300002907|JGI25613J43889_10208917 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300002914|JGI25617J43924_10089345 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300004114|Ga0062593_100493615 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300004157|Ga0062590_100574761 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300004268|Ga0066398_10179347 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300004463|Ga0063356_100119081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2924 | Open in IMG/M |
3300005093|Ga0062594_100244102 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300005093|Ga0062594_101082931 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300005093|Ga0062594_103262295 | Not Available | 509 | Open in IMG/M |
3300005180|Ga0066685_10500270 | Not Available | 841 | Open in IMG/M |
3300005289|Ga0065704_10097268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2403 | Open in IMG/M |
3300005293|Ga0065715_10764745 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300005328|Ga0070676_10811955 | Not Available | 691 | Open in IMG/M |
3300005329|Ga0070683_101765890 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300005330|Ga0070690_100449840 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300005330|Ga0070690_101413819 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300005331|Ga0070670_100137666 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
3300005331|Ga0070670_101702731 | Not Available | 580 | Open in IMG/M |
3300005332|Ga0066388_100886223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1473 | Open in IMG/M |
3300005332|Ga0066388_101064409 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300005332|Ga0066388_101674457 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300005334|Ga0068869_100512327 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300005340|Ga0070689_100229403 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
3300005343|Ga0070687_100337781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
3300005345|Ga0070692_10777359 | Not Available | 652 | Open in IMG/M |
3300005353|Ga0070669_100632520 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300005364|Ga0070673_101017434 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300005365|Ga0070688_100416145 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300005434|Ga0070709_11734220 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005438|Ga0070701_10559010 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300005440|Ga0070705_101010003 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300005440|Ga0070705_101915048 | Not Available | 505 | Open in IMG/M |
3300005444|Ga0070694_101259915 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005444|Ga0070694_101476010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 575 | Open in IMG/M |
3300005445|Ga0070708_100118497 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
3300005445|Ga0070708_100455844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1206 | Open in IMG/M |
3300005445|Ga0070708_100818025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
3300005445|Ga0070708_100866188 | Not Available | 848 | Open in IMG/M |
3300005445|Ga0070708_102270005 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005467|Ga0070706_100022261 | All Organisms → cellular organisms → Bacteria | 5836 | Open in IMG/M |
3300005467|Ga0070706_100226976 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300005468|Ga0070707_100146366 | All Organisms → cellular organisms → Bacteria | 2300 | Open in IMG/M |
3300005471|Ga0070698_100018186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7400 | Open in IMG/M |
3300005471|Ga0070698_100079090 | All Organisms → cellular organisms → Bacteria | 3285 | Open in IMG/M |
3300005471|Ga0070698_100779450 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300005471|Ga0070698_101725903 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300005471|Ga0070698_101814351 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300005471|Ga0070698_102076178 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005518|Ga0070699_101179362 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300005536|Ga0070697_100004844 | All Organisms → cellular organisms → Bacteria | 10319 | Open in IMG/M |
3300005536|Ga0070697_100005375 | All Organisms → cellular organisms → Bacteria | 9854 | Open in IMG/M |
3300005536|Ga0070697_100269667 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300005536|Ga0070697_100525727 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300005536|Ga0070697_101205546 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005544|Ga0070686_100166571 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300005545|Ga0070695_101251714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 612 | Open in IMG/M |
3300005547|Ga0070693_100249996 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300005549|Ga0070704_100121861 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
3300005563|Ga0068855_101479137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 698 | Open in IMG/M |
3300005577|Ga0068857_101501219 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300005718|Ga0068866_10045731 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
3300005719|Ga0068861_100909753 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300005719|Ga0068861_101147842 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005840|Ga0068870_10005419 | All Organisms → cellular organisms → Bacteria | 5571 | Open in IMG/M |
3300005840|Ga0068870_10748081 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300005841|Ga0068863_100147117 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
3300005843|Ga0068860_100784142 | Not Available | 966 | Open in IMG/M |
3300005843|Ga0068860_100973709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
3300005844|Ga0068862_100011825 | All Organisms → cellular organisms → Bacteria | 7207 | Open in IMG/M |
3300005983|Ga0081540_1134807 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300006049|Ga0075417_10389811 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300006173|Ga0070716_101776955 | Not Available | 510 | Open in IMG/M |
3300006794|Ga0066658_10447996 | Not Available | 703 | Open in IMG/M |
3300006844|Ga0075428_101703051 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300006845|Ga0075421_100319858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1882 | Open in IMG/M |
3300006845|Ga0075421_100585562 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
3300006847|Ga0075431_100959812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
3300006852|Ga0075433_10006493 | All Organisms → cellular organisms → Bacteria | 9246 | Open in IMG/M |
3300006852|Ga0075433_10039197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4095 | Open in IMG/M |
3300006852|Ga0075433_10321208 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300006852|Ga0075433_10729970 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300006852|Ga0075433_11167889 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300006852|Ga0075433_11582013 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300006854|Ga0075425_100541222 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300006854|Ga0075425_101701697 | Not Available | 710 | Open in IMG/M |
3300006871|Ga0075434_100151820 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
3300006871|Ga0075434_100189727 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
3300006871|Ga0075434_102309202 | Not Available | 541 | Open in IMG/M |
3300006880|Ga0075429_100914566 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300006881|Ga0068865_100519968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
3300006894|Ga0079215_11296649 | Not Available | 562 | Open in IMG/M |
3300006904|Ga0075424_101503839 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300006904|Ga0075424_102715398 | Not Available | 517 | Open in IMG/M |
3300006931|Ga0097620_101667909 | Not Available | 704 | Open in IMG/M |
3300006954|Ga0079219_11619999 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300007076|Ga0075435_100120129 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
3300007076|Ga0075435_101047969 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300007076|Ga0075435_101341943 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300007255|Ga0099791_10135270 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300009012|Ga0066710_100211774 | All Organisms → cellular organisms → Bacteria | 2770 | Open in IMG/M |
3300009038|Ga0099829_11033205 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300009088|Ga0099830_10070742 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
3300009088|Ga0099830_11473434 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300009089|Ga0099828_11432701 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300009090|Ga0099827_10481720 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300009092|Ga0105250_10235605 | Not Available | 779 | Open in IMG/M |
3300009098|Ga0105245_10126786 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
3300009100|Ga0075418_10437440 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300009100|Ga0075418_12645427 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300009101|Ga0105247_10317481 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300009147|Ga0114129_10442755 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
3300009147|Ga0114129_10854753 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300009147|Ga0114129_11206799 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300009147|Ga0114129_11427660 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300009147|Ga0114129_11627675 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300009148|Ga0105243_10241560 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
3300009157|Ga0105092_10329744 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300009162|Ga0075423_10043003 | All Organisms → cellular organisms → Bacteria | 4628 | Open in IMG/M |
3300009162|Ga0075423_12812773 | Not Available | 533 | Open in IMG/M |
3300009174|Ga0105241_10732421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
3300009176|Ga0105242_10248471 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
3300009177|Ga0105248_11526740 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300010040|Ga0126308_10485116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
3300010043|Ga0126380_11794653 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300010046|Ga0126384_10100545 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
3300010047|Ga0126382_10040718 | All Organisms → cellular organisms → Bacteria | 2639 | Open in IMG/M |
3300010358|Ga0126370_10977396 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300010359|Ga0126376_12637932 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300010360|Ga0126372_10234797 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
3300010360|Ga0126372_12430372 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300010362|Ga0126377_10537009 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300010362|Ga0126377_10868070 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300010362|Ga0126377_13568778 | Not Available | 503 | Open in IMG/M |
3300010371|Ga0134125_11816485 | Not Available | 663 | Open in IMG/M |
3300010399|Ga0134127_10459047 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
3300010400|Ga0134122_10071506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2697 | Open in IMG/M |
3300010400|Ga0134122_11310832 | Not Available | 732 | Open in IMG/M |
3300010400|Ga0134122_12689701 | Not Available | 549 | Open in IMG/M |
3300010401|Ga0134121_11546016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 681 | Open in IMG/M |
3300010403|Ga0134123_12594755 | Not Available | 574 | Open in IMG/M |
3300011269|Ga0137392_10046590 | All Organisms → cellular organisms → Bacteria | 3242 | Open in IMG/M |
3300011269|Ga0137392_10816691 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300011271|Ga0137393_10426887 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300012189|Ga0137388_10432635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 1220 | Open in IMG/M |
3300012189|Ga0137388_10515122 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300012201|Ga0137365_10986548 | Not Available | 611 | Open in IMG/M |
3300012203|Ga0137399_10070577 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
3300012203|Ga0137399_11278414 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300012203|Ga0137399_11522070 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300012205|Ga0137362_10309749 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300012205|Ga0137362_11603118 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300012211|Ga0137377_11044947 | Not Available | 747 | Open in IMG/M |
3300012354|Ga0137366_10041808 | All Organisms → cellular organisms → Bacteria | 3545 | Open in IMG/M |
3300012363|Ga0137390_10011176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7973 | Open in IMG/M |
3300012363|Ga0137390_10810918 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300012469|Ga0150984_103723188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300012582|Ga0137358_10478504 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300012685|Ga0137397_10471925 | Not Available | 935 | Open in IMG/M |
3300012685|Ga0137397_10512073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 894 | Open in IMG/M |
3300012685|Ga0137397_10708984 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300012685|Ga0137397_11136686 | Not Available | 566 | Open in IMG/M |
3300012685|Ga0137397_11266206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 527 | Open in IMG/M |
3300012899|Ga0157299_10349732 | Not Available | 507 | Open in IMG/M |
3300012918|Ga0137396_10093641 | All Organisms → cellular organisms → Bacteria | 2135 | Open in IMG/M |
3300012918|Ga0137396_10615561 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300012922|Ga0137394_10117393 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
3300012922|Ga0137394_10354070 | Not Available | 1253 | Open in IMG/M |
3300012922|Ga0137394_11048388 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300012923|Ga0137359_10992967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
3300012923|Ga0137359_11699660 | Not Available | 518 | Open in IMG/M |
3300012925|Ga0137419_10021609 | All Organisms → cellular organisms → Bacteria | 3772 | Open in IMG/M |
3300012925|Ga0137419_10059728 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
3300012927|Ga0137416_10263203 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300012929|Ga0137404_11523247 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012929|Ga0137404_11631088 | Not Available | 598 | Open in IMG/M |
3300012929|Ga0137404_11775323 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300012931|Ga0153915_10999707 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300012938|Ga0162651_100040078 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300012944|Ga0137410_10138552 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
3300012944|Ga0137410_11068820 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300012944|Ga0137410_11816834 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300012948|Ga0126375_10756549 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300012948|Ga0126375_10806263 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300012948|Ga0126375_12042185 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300013102|Ga0157371_11263716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300013297|Ga0157378_11657484 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300013297|Ga0157378_11722451 | Not Available | 674 | Open in IMG/M |
3300013306|Ga0163162_13094312 | Not Available | 534 | Open in IMG/M |
3300013306|Ga0163162_13211815 | Not Available | 524 | Open in IMG/M |
3300013307|Ga0157372_11088225 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300013307|Ga0157372_11544491 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300013754|Ga0120183_1003283 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300014326|Ga0157380_11194447 | Not Available | 804 | Open in IMG/M |
3300014326|Ga0157380_11376263 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300014326|Ga0157380_11691129 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300014745|Ga0157377_10384920 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300014965|Ga0120193_10002363 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300015241|Ga0137418_11044990 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300015245|Ga0137409_10243430 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
3300015371|Ga0132258_13663483 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300015372|Ga0132256_100883645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1010 | Open in IMG/M |
3300015373|Ga0132257_100168265 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
3300018000|Ga0184604_10107307 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300018054|Ga0184621_10097506 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300018061|Ga0184619_10471649 | Not Available | 557 | Open in IMG/M |
3300018071|Ga0184618_10251086 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300018084|Ga0184629_10285619 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300018429|Ga0190272_10021386 | All Organisms → cellular organisms → Bacteria | 3368 | Open in IMG/M |
3300018468|Ga0066662_11622445 | Not Available | 675 | Open in IMG/M |
3300018469|Ga0190270_10595179 | Not Available | 1076 | Open in IMG/M |
3300018476|Ga0190274_12951177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
3300019360|Ga0187894_10025504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3978 | Open in IMG/M |
3300019360|Ga0187894_10144744 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300019487|Ga0187893_10012528 | All Organisms → cellular organisms → Bacteria | 11999 | Open in IMG/M |
3300019883|Ga0193725_1095346 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300020004|Ga0193755_1216172 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300022694|Ga0222623_10144112 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300025327|Ga0209751_10099073 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
3300025899|Ga0207642_10001985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6308 | Open in IMG/M |
3300025900|Ga0207710_10742043 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300025907|Ga0207645_10367016 | Not Available | 965 | Open in IMG/M |
3300025907|Ga0207645_10633961 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300025908|Ga0207643_10058042 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
3300025908|Ga0207643_10376188 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300025910|Ga0207684_10021814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5467 | Open in IMG/M |
3300025910|Ga0207684_10460872 | Not Available | 1091 | Open in IMG/M |
3300025910|Ga0207684_10729004 | Not Available | 841 | Open in IMG/M |
3300025911|Ga0207654_10200741 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
3300025911|Ga0207654_10251767 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300025911|Ga0207654_11194468 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300025918|Ga0207662_10181601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1354 | Open in IMG/M |
3300025918|Ga0207662_10193472 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
3300025922|Ga0207646_10150075 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
3300025922|Ga0207646_10714559 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300025922|Ga0207646_11243343 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300025925|Ga0207650_10045564 | All Organisms → cellular organisms → Bacteria | 3226 | Open in IMG/M |
3300025925|Ga0207650_11157633 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300025926|Ga0207659_11717228 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300025934|Ga0207686_10099380 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
3300025934|Ga0207686_10994714 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300025934|Ga0207686_11085714 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300025935|Ga0207709_11137021 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 642 | Open in IMG/M |
3300025937|Ga0207669_10330382 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300025938|Ga0207704_10764535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
3300025939|Ga0207665_10354700 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300025941|Ga0207711_10409151 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300025942|Ga0207689_10745988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
3300025949|Ga0207667_11296006 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 705 | Open in IMG/M |
3300025960|Ga0207651_11774198 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300025961|Ga0207712_10786381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
3300026035|Ga0207703_10868498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriales incertae sedis → Microseira → Microseira wollei | 863 | Open in IMG/M |
3300026088|Ga0207641_10128580 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
3300026088|Ga0207641_10799917 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300026089|Ga0207648_10266580 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300026089|Ga0207648_10761506 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300026304|Ga0209240_1252402 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300026320|Ga0209131_1057501 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
3300026551|Ga0209648_10419578 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300026551|Ga0209648_10594671 | Not Available | 610 | Open in IMG/M |
3300027603|Ga0209331_1066306 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300027657|Ga0256865_1101092 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300027873|Ga0209814_10092576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1279 | Open in IMG/M |
3300027875|Ga0209283_10205603 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300027886|Ga0209486_10116063 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
3300027903|Ga0209488_10186969 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
3300027909|Ga0209382_10638478 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300028380|Ga0268265_10298834 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300028380|Ga0268265_11076514 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300028381|Ga0268264_10869560 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300028381|Ga0268264_10958297 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300028381|Ga0268264_11036821 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300028381|Ga0268264_12084667 | Not Available | 576 | Open in IMG/M |
3300031164|Ga0307502_10009208 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
3300031456|Ga0307513_11093467 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 509 | Open in IMG/M |
3300031538|Ga0310888_10004437 | All Organisms → cellular organisms → Bacteria | 4785 | Open in IMG/M |
3300031720|Ga0307469_10578494 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300031740|Ga0307468_100017208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3073 | Open in IMG/M |
3300031740|Ga0307468_101088613 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300031740|Ga0307468_101755323 | Not Available | 586 | Open in IMG/M |
3300031820|Ga0307473_10501482 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300031908|Ga0310900_11557770 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300032180|Ga0307471_101316969 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300032180|Ga0307471_103733166 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300032205|Ga0307472_100452912 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.49% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.77% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.77% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.08% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.38% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.38% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.38% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.04% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.04% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.35% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.35% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.35% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.35% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.35% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.35% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.35% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.35% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.35% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.35% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.35% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.35% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.35% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.35% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013754 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031164 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_S | Environmental | Open in IMG/M |
3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4PV_03092810 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | MSEEDLEVLITLDDPEDPEKEDTFHNLEADYGVSHRPGQPQQGGDPTKKK |
JGI11615J12901_110940112 | 3300000953 | Soil | MSEEELELLITLDDPEDPEKEDNFHHNKSDSIARPQGQLQEGGDPTRKLE* |
JGI1027J12803_1051632351 | 3300000955 | Soil | MSEEDLEVLITLDDEEDPEKEDTFHNPDNGMAHWPGQPQQGGDPTKRSNCR* |
JGI25613J43889_102089171 | 3300002907 | Grasslands Soil | MSQEDLELLITMDDPGEDTLEEDTFHLQSDNMTASRSGQPQQGGDPTSKQK* |
JGI25617J43924_100893452 | 3300002914 | Grasslands Soil | MSQEDLEVLITLDDPGEDTLEEDTFHLQADKTTAGRSGQPEQGGDPTSKQE* |
Ga0062593_1004936153 | 3300004114 | Soil | MSEEDLELLVTIDDPGEDTLEEDTFHLQSDNMTGQPQQGG |
Ga0062590_1005747611 | 3300004157 | Soil | MSEEDLELLVTIDDPGEDTLEEDTFHLQSDNMTGQPQQGGRPTSKQGHS* |
Ga0066398_101793472 | 3300004268 | Tropical Forest Soil | MSEEDLELLITTDDPGEDTLEEDTFHLQSDNLTARRSAQPQQGGDPTSKQK* |
Ga0063356_1001190812 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSEEDLELLITTDDPGEDSLEEDTFHLQAKNTVGARFQKGGDPTSKQKVIAENDPQS* |
Ga0062594_1002441022 | 3300005093 | Soil | MSEEDLELLITTDDPGEDTLEEDTFHLRSDNMTARRSGQPQQGGDPTSKQK* |
Ga0062594_1010829311 | 3300005093 | Soil | MSEEAQELLITMDDPGEDTLEEDTFHIQSDNTTARRSGQPQQVGDLTTKQK* |
Ga0062594_1032622951 | 3300005093 | Soil | MSEEDLELLVTIDDPGEDTLEEDTFHLQSDSLTGQPQQGGRPTSKQGHS* |
Ga0066685_105002702 | 3300005180 | Soil | MSQEDLELLVTMDDPGEDALEEDTFHLQSDDMTARRSGQPQEGGDPASKPK* |
Ga0065704_100972682 | 3300005289 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDALEEDTFHLRSDNMTARRSGQPQQGGDPTSKQK* |
Ga0065715_107647451 | 3300005293 | Miscanthus Rhizosphere | MSEEDLELVITTDDPGEDSLDEDTFHQGDNATARPSGQTQQGGDGIGKRK* |
Ga0070676_108119551 | 3300005328 | Miscanthus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNATARGSGEPQQGSDPTSKQR* |
Ga0070683_1017658901 | 3300005329 | Corn Rhizosphere | MSEEDVELLITMDDPGEDSLEEDTFHLQADNKTARWSGQPEYAEGVR* |
Ga0070690_1004498402 | 3300005330 | Switchgrass Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNTITPRSGQPQQGGEPNSKQK* |
Ga0070690_1014138192 | 3300005330 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDSLDEDTFHQGDNATARPSGQAQQGGDGIGKRK* |
Ga0070670_1001376663 | 3300005331 | Switchgrass Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDTFHLQADNTTARRSGQPQQGGDPTSKQK* |
Ga0070670_1017027311 | 3300005331 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDSLDEDTFHQGDNATARPSSQAQQGGDGIGKQK* |
Ga0066388_1008862232 | 3300005332 | Tropical Forest Soil | MSEEDLELLITTDDPGEDTLEEDTFHLKNDNTSARVQGDDPTK* |
Ga0066388_1010644091 | 3300005332 | Tropical Forest Soil | MNEEELEVLVTLDDPGEDTLEEDTFHLHADNTTATRSDQPCDPTNKQK* |
Ga0066388_1016744572 | 3300005332 | Tropical Forest Soil | MSEEDLELLITTDDPGEDSLEEDTFHLKSDNAIADQPQPAGDPTSKQK* |
Ga0068869_1005123271 | 3300005334 | Miscanthus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNAPARRSGQPQQGGDPTSKQE* |
Ga0070689_1002294033 | 3300005340 | Switchgrass Rhizosphere | MSEEDLEILITIDDPGEDTLEEDTFHLQADNTIAQPQRAGDPASKQK* |
Ga0070687_1003377811 | 3300005343 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDALEEDTFHLRSDNMTARRPGQPQQGGDPTSKQK* |
Ga0070692_107773591 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEAQELLITMDDPGEDTLEEDTFHIQSDNTTARRSGQPQQVGDLTSKLK* |
Ga0070669_1006325202 | 3300005353 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDSLDEDTFHQGDNATTRPSGQAQQGGDGIGKRK* |
Ga0070673_1010174342 | 3300005364 | Switchgrass Rhizosphere | MSEEDLEILITIDDPGEDTLEEDTFHQAGNTITPRSGQPQQGGEPNSKQK* |
Ga0070688_1004161452 | 3300005365 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDSLDEDTFHQGDNATARPSGQAQQGGDGIGKRN* |
Ga0070709_117342201 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENLELLITMDDPGEDTLEEDTFHLQADNTTAGRSGQPQQGGEPTSKQK* |
Ga0070701_105590102 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITTDDPGEDSLDEDTFHQGDNATARPSGQTQQGGDGIGKQK* |
Ga0070705_1010100031 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITLDDPEDPEKEDTFHHLQADHTIADWPDQPQPGGDPTSKQK* |
Ga0070705_1019150482 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITTDDPGEDSLEEDTFHQGDNATARPSGQAQQGGDGTGNRK* |
Ga0070694_1012599152 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDVELLVTMDDPGEDTLEEDTFHLQADNTTARWSSQPQHGGNPTSKQK* |
Ga0070694_1014760102 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLEVLITLDDPEDPDKEDTFHNLVADNVVAHRPGQPQQGGDPTKKE* |
Ga0070708_1001184974 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITMDDPGEDTLEEDTFHLQSDDMTARPSGQPQEGGDPASKPK* |
Ga0070708_1004558443 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLIATDDPGEDTLEEDNFHLQADNTTARRSGQPQQGGDPTSKQK* |
Ga0070708_1008180252 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITLDDPEDPEKEDTFHPLQADNTVAHLPGQPQQGGDPTSKQK* |
Ga0070708_1008661881 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENLEVLITLDDPGEDTLEEDTFHQAGNATARGSGQPQQGGDPTSRQE* |
Ga0070708_1022700052 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VFALEVHMSEEDLELLITLDDPEDPEKEDTFHHLQADNAVADWPGQPQQGGDPTSKQK* |
Ga0070706_1000222612 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITLDDPEDPEKEDTFHHLQADNAVADWPGQPQQGGDATSKQK* |
Ga0070706_1002269762 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENLELLITMDDPGEDTLEEDTFHLQADNMTARRSGQPQQGGEPTSKKK* |
Ga0070707_1001463661 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQADNATARRSGQPQQGGDPTSKQK* |
Ga0070698_1000181865 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITTDDPGEDTLEEDTFHLQSDNMTAHRSGQPQQGGDPTSKQK* |
Ga0070698_1000790903 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITLDDPEDPEKEDTFHHLQADNAVADWPGQPQQGGDPTSKQK* |
Ga0070698_1007794503 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITTDDPGEDTLDEDTFHQADKATGHRSGQPPQDRDPTRQN* |
Ga0070698_1017259032 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ELLITMDDPGEDTLEEDTFHLQADNTTARRSGQPQQGGDPTSKQK* |
Ga0070698_1018143512 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENLEVLITLDDPGEDNLEEDTFHQAGNATARGSGQPQQGGDPTSRQE* |
Ga0070698_1020761782 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ELLITMDDPGEDTLEEDTFHLQSDDMTARRSGRPQQSGDLTSKQK* |
Ga0070699_1011793621 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DDPGEDTLEEDTFHLQADNTTARRSGQPQRGGDPTSKQK* |
Ga0070697_1000048445 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLIAMDDPGEDALEEDTFHLQTGNATARPSGQPQHGGDPTRKQK* |
Ga0070697_10000537511 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDWESLITLDDPGEDDLEEDTFHHQSDNMTARWSGQPQEGGDPASKQK* |
Ga0070697_1002696672 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDMEVLIAMDDPGEDTLEEDTFHLQSDNLTARQSIQPQQGGESTSKQK* |
Ga0070697_1005257272 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDTFHLQADNTTARRSGQPQQGGESTSQ* |
Ga0070697_1012055461 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITMDDLGEDTLEEDTCHLQADNTTTRRSGQPQQGGEPTSRQK* |
Ga0070686_1001665714 | 3300005544 | Switchgrass Rhizosphere | MSEEDLEVLITLDDPGEEDLEEDTFHNPPAESVVAPRPGQPKPGGDLMKSTRFTAR* |
Ga0070695_1012517142 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLESLITLDDPGEDDLEEDTFHHQSDNMTARWSGQPQEGGDPASKQK* |
Ga0070696_1010766281 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLDALITLDDPGEDTLEEDTFHHLQADNTVAPWPQQGDPAGKQR* |
Ga0070693_1002499961 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEAQELLITMDDPGEDTLEEDTFHIQSDNTTARRSGQPQQVG |
Ga0070704_1001218614 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHVKADKTTAGRPGQAQQGGEPTSKKK* |
Ga0068855_1014791372 | 3300005563 | Corn Rhizosphere | MSEEDLEVLITLDDEEDPEKEDTFHNPDNGMAHWPGQPQQGGDPTKKK* |
Ga0068857_1015012191 | 3300005577 | Corn Rhizosphere | MSEEDLELLITLDDPGEETLEEDTFHLEADNPTALRSGQRQRGGDPTNNS* |
Ga0068866_100457312 | 3300005718 | Miscanthus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHLKVDKTTSGRSGQPQQGGDPASKNK* |
Ga0068861_1009097532 | 3300005719 | Switchgrass Rhizosphere | TLRQWWEVQMSEEDLELLVTIDDPGEDTLEEDTFHLQSDNMTGQPQQGGRPTSKQGHS* |
Ga0068861_1011478422 | 3300005719 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDTLEEDTFHQADKATGHRSDQPPQDRELTRQN* |
Ga0068870_100054193 | 3300005840 | Miscanthus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDTFHLQADNTTARRSGQPQQGGARSANRSNP* |
Ga0068870_107480811 | 3300005840 | Miscanthus Rhizosphere | PGEDSLEEDTFHLHADNTTNRRSGQPQQVGDPTSKKK* |
Ga0068863_1001471174 | 3300005841 | Switchgrass Rhizosphere | MSEEDMELLITTDDPGEDTLEEDTFHLKADNTTAARPGQHQQGGDSTVRQT* |
Ga0068860_1007841422 | 3300005843 | Switchgrass Rhizosphere | MSEEDLEVLITIDDPGEDTLEEDTFHLHPENTILQPQPGSDPTSKQKA* |
Ga0068860_1009737091 | 3300005843 | Switchgrass Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHLQADNTIAQPQRAGDPASKQK* |
Ga0068862_1000118252 | 3300005844 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDALEEDTFHLRSDNMTARRSGQPQQDGDPTSKQK* |
Ga0081540_11348072 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MSEEDLEVLITLDDPEDPEKEDTFHQLQADNAVANWPGRPQQESDPSGKPK* |
Ga0075417_103898112 | 3300006049 | Populus Rhizosphere | MSEEDLELLITTDDPGEDSLEEDTFHVQADNLTARRTGQPQQVGDPTSKQK* |
Ga0070716_1017769551 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENLELLITMDDPGEDTLEEDTFHLQADKTTAGRSGQPQQGGEPTSKQK* |
Ga0066658_104479961 | 3300006794 | Soil | MSEENLELLITMDDPGEDTLEEDTFHLQSDNMTSSRSGQPQQGGDPTSKQK* |
Ga0075428_1017030511 | 3300006844 | Populus Rhizosphere | MSEEDLELLITTDDPGEDSLEEDTFHLHADNTTNRRSGQPQQVGD |
Ga0075421_1003198583 | 3300006845 | Populus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDTFHLQTDNTIARRSGQPQQGGDPTSKQK* |
Ga0075421_1005855622 | 3300006845 | Populus Rhizosphere | VLRQCLEVNMSDEDLEELITVDDPGEDTLEEDTFHQAGNTTARRSGQPQQGGDPTSKQE* |
Ga0075431_1009598123 | 3300006847 | Populus Rhizosphere | EDTLEEDTFHLQTDNTIARRSGQPQQGGDPTSKQK* |
Ga0075433_100064938 | 3300006852 | Populus Rhizosphere | MSEEDQELLITMDDPGEDTLEEDTFHPQSDDNTARRSGRPQQSGDLTSKQK* |
Ga0075433_100391973 | 3300006852 | Populus Rhizosphere | MSEEDLEVLITLDDEEDPEKEDTFHNPDNGMVHWPSQPQQGGDPTKKK* |
Ga0075433_103212082 | 3300006852 | Populus Rhizosphere | MGEEDLEVLITLDDPGEDTLEEDTFHQAESVTTRRSGQPQQGADPTSKQE* |
Ga0075433_107299702 | 3300006852 | Populus Rhizosphere | MREEDLELLIEMDDPGEDTLEEDTFHLHADNTTGQPQRGGDPTKGNS* |
Ga0075433_111678892 | 3300006852 | Populus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDAFHLQADITTARRSGQPQQGGDQTSKQK* |
Ga0075433_115820131 | 3300006852 | Populus Rhizosphere | LITLDDPGEDTLEEDTFHQAGNTTARRSGQPQQGDDPASKQK* |
Ga0075425_1005412223 | 3300006854 | Populus Rhizosphere | MTEEDLELLITTDDPGEDTLEEDTFHLQADNTTARRSGQPQQGGEPTSKQK* |
Ga0075425_1017016972 | 3300006854 | Populus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNVTTHRPGQHQQGGDPTIKQK* |
Ga0075434_1001518202 | 3300006871 | Populus Rhizosphere | MSEEDLEVLITLDDEEDPEKEDTFHNPDNGMPHWPGQPQQGGDPTKKK* |
Ga0075434_1001897271 | 3300006871 | Populus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQADNVTARGSGQPQQGDDPASKQE* |
Ga0075434_1023092021 | 3300006871 | Populus Rhizosphere | LEVLITLDDPEDPDKEDTFHNLVADNVVAHRPGQPQQGADPTKKE* |
Ga0075429_1009145662 | 3300006880 | Populus Rhizosphere | MSEEDMELLITTDDPGEDTLEEDTFHLKSDNTIAHQPQEVGEPISKK* |
Ga0068865_1005199681 | 3300006881 | Miscanthus Rhizosphere | MSEEDLELLITTDDPGEDTLEEDTFHLRSDNMTARRSGQPQQDGDPTSKQK* |
Ga0079215_112966492 | 3300006894 | Agricultural Soil | MSEEDMELLITTDDPGEDALEEDTFHLKADNTTAGRSGQNQQGDDSTSRQK* |
Ga0075424_1015038391 | 3300006904 | Populus Rhizosphere | EDLELRIARMTPGEDTFHLQADNTTAGRSGQPQQSGEPTSKQK* |
Ga0075424_1027153981 | 3300006904 | Populus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDAFHLQADITTARRSGQPQQGGD |
Ga0097620_1016679091 | 3300006931 | Switchgrass Rhizosphere | MSEEDLEVLITMDDPGEDTLEEDTFHLHPENTILQPQPGSDPTSKQKA* |
Ga0079219_116199992 | 3300006954 | Agricultural Soil | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNAPTRRSGRPQQGGDPTSKPE* |
Ga0075435_1001201292 | 3300007076 | Populus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDAFHLQADITTARRSGQPQQGGDPTSKQK* |
Ga0075435_1010479692 | 3300007076 | Populus Rhizosphere | EEDLEVLITLDDPGEDTLEEDTFHQPDNVTTHRPGQHQQGGDPTIKQK* |
Ga0075435_1013419432 | 3300007076 | Populus Rhizosphere | MSEEDLELLIAMDDPGEDTLEENTFHFQADKTTAGRSGQPQQSGEPTSKQK* |
Ga0099791_101352701 | 3300007255 | Vadose Zone Soil | MSEEDVELLITMDDPGEDTLEEDTFHLQSDNMTARRSGQPQQGGDPTSKQK* |
Ga0066710_1002117743 | 3300009012 | Grasslands Soil | MSQEDLELLVTMDDPGEDALEEDTFHLQSDDMTARRSGQPQEGGDPASKPK |
Ga0099829_110332052 | 3300009038 | Vadose Zone Soil | MSEENLELLITMDDPGEDTLEEDTFHLQSDNMTASRSGQPQQGGDPTSKQK* |
Ga0099830_100707425 | 3300009088 | Vadose Zone Soil | MSQEDLELLITMDDPGEDALEEDTFHLQSDNMTASRSGQPQQGGDSTSKQK* |
Ga0099830_114734341 | 3300009088 | Vadose Zone Soil | MSQEDLELLITMDDPGEDTLEEDTFHLQSDNVTASRSGQPQQAGDPTSKQK* |
Ga0099828_114327011 | 3300009089 | Vadose Zone Soil | RNEYYLEIHMSEEDLELLITLDDPEDPEKEDTFHHLQADNTAAHWPDQPQQGGDATSKQK |
Ga0099828_115503652 | 3300009089 | Vadose Zone Soil | MLFALEVHMSEEDLELLITLDDPGEDALEEDTFNHSQAGNTLAYEPGQPLPS |
Ga0099827_104817202 | 3300009090 | Vadose Zone Soil | MSEENLELLITMDDPGEDTLEEDTFHLQSDSVTASRSGQPQQAGDPTSKQK* |
Ga0105250_102356051 | 3300009092 | Switchgrass Rhizosphere | MSEEDLEVLITLDDEEDPEKEDTFHNLDNGVAHWPGQPQQGGDPTKKK* |
Ga0105245_101267862 | 3300009098 | Miscanthus Rhizosphere | MSEEDMELLITTDDQGEDTLEEDTFHLKADNTIAGPSGQHQQGGDSTVRQK* |
Ga0075418_104374401 | 3300009100 | Populus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDTFHLQADNTIAHRSGQSQQGGHPTSKQK* |
Ga0075418_126454271 | 3300009100 | Populus Rhizosphere | MSEEDLELLITTDDPGEDTLEEDTFHLKSDNAIAHQPQQVGDPTSKQK* |
Ga0105247_103174813 | 3300009101 | Switchgrass Rhizosphere | MSEEDLESLVTIDDPGEDTLEEDTFHLQSDSMTGQPQQGGRPTSKQGHS* |
Ga0114129_104427552 | 3300009147 | Populus Rhizosphere | MSEEDLELLITLDDPGEDTLEEDTFHQAGNATARRSGQPQQGDDSTSKQE* |
Ga0114129_108547531 | 3300009147 | Populus Rhizosphere | EEDLELLIAMDDPGEDTLEEDTFHLQSDNLTARRSGQPQQGGDPTSKQK* |
Ga0114129_112067991 | 3300009147 | Populus Rhizosphere | MSEEDLELLIAMDDPGEDALEEDTFHLQTDNTIARRSGQPQQGGDPTSKQK |
Ga0114129_114276602 | 3300009147 | Populus Rhizosphere | MSFALELHMSEEDLELLITTDDPGEDTLEEDTFHLQADNTTARRSGQPQQGGDPTSKQK* |
Ga0114129_116276753 | 3300009147 | Populus Rhizosphere | MSEEDLELLITTDDPGEDTLEEDTFHLKSDNAIAHQPQQGGDPTSKQK* |
Ga0105243_102415603 | 3300009148 | Miscanthus Rhizosphere | MSEEDLELLITTDDPGEDSLDEDTFHQGDNATARPSGQAQQGGDGIAKRK* |
Ga0105092_103297442 | 3300009157 | Freshwater Sediment | MSEEDMELLITTDDPGEDTLEEDTFHLKADNTTAGRSGQHQQGGDSTSRQK* |
Ga0075423_100430034 | 3300009162 | Populus Rhizosphere | MSEEDQELLITMDDPGEDTLEEDTFHPQSDDMTARRSGRPQQSGDLTSKQK* |
Ga0075423_128127732 | 3300009162 | Populus Rhizosphere | MSEEDLEILITIDDPGEDTLEEDAFHLQADNAIAQPQRVGDSTGKQK* |
Ga0105241_107324211 | 3300009174 | Corn Rhizosphere | MSEEDLELLIATDDPGEDTLEEDTFHLQADNLTAHGSGQLQSGIDPTK* |
Ga0105242_102484712 | 3300009176 | Miscanthus Rhizosphere | MLFALEVHMSEEDLELLVTLDDPGEDTLEEDTFHHLQADDTLADWPGQPQQGGDPISKQK |
Ga0105248_115267402 | 3300009177 | Switchgrass Rhizosphere | VSEEDLEVLITLDDPGEDTLEEDTFHLRTDKTTASRSGQPQQGGDPASKKK* |
Ga0126308_104851162 | 3300010040 | Serpentine Soil | MSEEDLEVLITLDDPGEDALEEDTFHQTDNGGAHRDGLSEQRGRFATKQN* |
Ga0126380_117946531 | 3300010043 | Tropical Forest Soil | MSEEDLELLITTDDPGEDTLEEDTFHLQADDTTERRTGQPQQGGDASSKQK* |
Ga0126384_101005453 | 3300010046 | Tropical Forest Soil | MNEEELEVLVTMDDPGEDTLEEDTFHLHADNTTAPLSDQPCDPTSKQK* |
Ga0126382_100407182 | 3300010047 | Tropical Forest Soil | MSEEDLELLITTDDPGEDTLEEDTFHLQSDNLTARRSAQPQQGGDPTANRNNS* |
Ga0126370_109773963 | 3300010358 | Tropical Forest Soil | MSEEDLELLITTDDPGEDSLEEDTFHLQPDNLTARRPSQPQQGGDPTSKQK* |
Ga0126376_126379322 | 3300010359 | Tropical Forest Soil | MSEEDLELLITTDDPGEDSLEEDTFHLQPDNLTARRSGQPQQGGDPTSKQK* |
Ga0126372_102347973 | 3300010360 | Tropical Forest Soil | MNEEELEVLVTMDDPGEDTLEEDTFHLHADNTTATRSDQPCDPTNKQK* |
Ga0126372_124303722 | 3300010360 | Tropical Forest Soil | MREEDLELLITIDDPGEDTLEEDTFHLQADNLTARRSGQPQLGGDPTSKQK* |
Ga0126377_105370092 | 3300010362 | Tropical Forest Soil | MSEEDLELLITTDDPGEDTLEEDTFHLQADNATAHQQGGDPTSKQK* |
Ga0126377_108680702 | 3300010362 | Tropical Forest Soil | MSEEDLELLITIDDPGEDTLEEDTFHLQADNLTVRRSGQPQLGGDPTSKQK* |
Ga0126377_135687781 | 3300010362 | Tropical Forest Soil | MSEEDLELLITTDDPGEDTLEEDTFHLKSDNTTALRSRQPQQGGDQTSKQK* |
Ga0134125_118164852 | 3300010371 | Terrestrial Soil | MSEEDLELVISMDDPGEDTLEEDTFHLQSDNMTARRSGQPQEGGDPTSKQK* |
Ga0134127_104590472 | 3300010399 | Terrestrial Soil | MLFALEVHMSEEDLELLVTLDDPGEDTLEEDPFHHLQADDTLADWPGHPQQGGDPISKQK |
Ga0134122_100715063 | 3300010400 | Terrestrial Soil | MLFVLEVHMSEEDLELLVTLDDPGEDTLEEDTFHHLQADNIVADWPGQPQQGGDPISKQK |
Ga0134122_113108323 | 3300010400 | Terrestrial Soil | MSEEDLEVLITLDDPEDPEKEDTFHDLKADSAGQPLLQSNDPSSKQK* |
Ga0134122_126897011 | 3300010400 | Terrestrial Soil | MSEEELEVLIAMDDPGEDTLEEDTFHLQADNTTARLQGGDSTSKQK* |
Ga0134121_115460162 | 3300010401 | Terrestrial Soil | MSEEDLEVLITLDDPGEDTLEEDTFHLKVDKTTSGRSGQPQQGGDPTSKQK* |
Ga0134123_125947552 | 3300010403 | Terrestrial Soil | MSEEDLELLITTDDPGEDTLEEDTFHLRSDNMTARRSGQPQQGGDPTSRSNT* |
Ga0137392_100465903 | 3300011269 | Vadose Zone Soil | MSEEDLEVLITLDDPGEDTLEEDTFHLQADKTTAGRSGQPEQGGDPTSKQE* |
Ga0137392_108166912 | 3300011269 | Vadose Zone Soil | MSQEDLELLITMDDPGEDTLEEDTFHLQSDNVTGSRSGQPQQAGDPTSKQK* |
Ga0137393_104268873 | 3300011271 | Vadose Zone Soil | MSEEDLELLITTDDPGEDTLEEDTFHLQADNTTTRRSGQPQQGGDPTSKQK* |
Ga0137388_104326351 | 3300012189 | Vadose Zone Soil | EDLEVLITLDDPGEDTLEEDTFHLQADKTTAGRSGQPEQGGDPTSKQE* |
Ga0137388_105151223 | 3300012189 | Vadose Zone Soil | MSEEDLEVLITLDDPGEDTLEEDTFHLQSDNVTASRSGQPQQAGDPTSKQK* |
Ga0137365_109865482 | 3300012201 | Vadose Zone Soil | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNATARGSGQPQQGGEPTSQQK* |
Ga0137399_100705773 | 3300012203 | Vadose Zone Soil | MSEEDVELLITMDDPGEDTLEEDTFHLQSDNMTASRSGQPQQGGDPTSKQK* |
Ga0137399_112784141 | 3300012203 | Vadose Zone Soil | MSEEDLELLITLDDPEDPEKEDTFHHLQADNTVAPRPGQPQPAGYPTSKQK* |
Ga0137399_115220702 | 3300012203 | Vadose Zone Soil | MSEEDLELLIAMDDPGEDTLEEDTFHLQSDNVTASRSGQPQQAGDPTSTQK* |
Ga0137362_103097493 | 3300012205 | Vadose Zone Soil | MSQEDLELLITIDDPGEDTLEEDTFHLQSDNMTASRSGQPQQAGDPTSKQK* |
Ga0137362_116031181 | 3300012205 | Vadose Zone Soil | MSEENLELLITMDDPGEDTLEEDTFHLQSDNMTASRSGQPQQ |
Ga0137377_110449472 | 3300012211 | Vadose Zone Soil | MSEEDLEVLITLDDPGEDTLEEDTFHLQGDNTTTRRSGQPQEGGDPAGKPK* |
Ga0137366_100418085 | 3300012354 | Vadose Zone Soil | MSEEDLELLIAMDDPGEDTLEEDTFHLQADNTTARRSGQPQQCGDPTSKQK* |
Ga0137390_100111767 | 3300012363 | Vadose Zone Soil | MSEEDLELLITLDDPEDPEKEDTFHHLQADNIAAHWPDQPQQGGDATSKQK* |
Ga0137390_108109181 | 3300012363 | Vadose Zone Soil | MSEEDLEVLITLDDPGEDTLEEDTFHLQSDNVTGSRSGHPQEGGDPASKPK* |
Ga0150984_1037231881 | 3300012469 | Avena Fatua Rhizosphere | MSEEDMELLITMDDPGDDTLEEDTFHLQAENTTPRWSSQPE* |
Ga0137358_104785041 | 3300012582 | Vadose Zone Soil | MSEEDVELLITMDDPGEDTLEEDTFHLQSDNVTASRSGQPQQAGDPTSKQK* |
Ga0137397_104719251 | 3300012685 | Vadose Zone Soil | MSEEDLELLITLDDPEDPEKEDTFHHLEADNTVAHRPSQPQQGGDPTGKQK* |
Ga0137397_105120732 | 3300012685 | Vadose Zone Soil | MSEENLEVLITVDDPGEDTLEEDTFHLQADKTTAGRSGQPEQGGDPTSKQE* |
Ga0137397_107089842 | 3300012685 | Vadose Zone Soil | MNVIALEVHMSEEDLEVRITLDDPGEDTLEDDTFHHLQADNTVAPRLEPQQGGDPTSKQK |
Ga0137397_111366862 | 3300012685 | Vadose Zone Soil | MSEEDVELLITMDDPGEDTLEEDTFHLQSDNMTARRSGQPQQGGDPASKPK* |
Ga0137397_112662061 | 3300012685 | Vadose Zone Soil | MSQEDLELLVTMDDPGEDTLEEDAFHLQSDDMTARQSGQPQERGDPASKPK* |
Ga0157299_103497322 | 3300012899 | Soil | EVHMSEEELELLITTDDPGEDSLEEDTFHQAEGTVGGRFPKGGSATSKQKIIADNDPQS* |
Ga0137396_100936411 | 3300012918 | Vadose Zone Soil | MSEEDVELLITMDDPGEDTLEEDTFHLQSDNMTARRSGQPQQGGNPTSKQK* |
Ga0137396_106155611 | 3300012918 | Vadose Zone Soil | MSEEDLELLITLDDPEDPEKEDTLHHLQADNTVAPRPGQPQQAGDPTSKQK* |
Ga0137394_101173934 | 3300012922 | Vadose Zone Soil | MSQEDLELLITMDDPGEDTLEEDTFHLQSDNMTASRSGQPQ* |
Ga0137394_103540702 | 3300012922 | Vadose Zone Soil | MSEEDLELLITLDDPEDPEKEDTFHHLEADNTAAHRPGQPQQGGDPTGKQK* |
Ga0137394_110483881 | 3300012922 | Vadose Zone Soil | MSQEDLELLVTMDDPGEDALEEDTFHLQSDDMTAGRSGQPQEGGDPASKPK* |
Ga0137359_109929672 | 3300012923 | Vadose Zone Soil | MSQEDLELLITMDDPGEDTLEEDTFHLQSDNVTGSRSGQPQQAGDPTSKKK* |
Ga0137359_116996602 | 3300012923 | Vadose Zone Soil | MSEENLEFLITIDDPGEDTLEEDTFHLQSDNMTASRSGQPQQGGDP |
Ga0137419_100216092 | 3300012925 | Vadose Zone Soil | MSEEDLELLITLDDPEDPEKEDTFHNLQADNTVAHRPGQPQQGGDPTSKQK* |
Ga0137419_100597283 | 3300012925 | Vadose Zone Soil | ELLITIDDPGEDTLKEDTFHLQSDNMTARRSGQPQQGGDPTSKQK* |
Ga0137416_102632031 | 3300012927 | Vadose Zone Soil | MSQVDVELLITMDDPGEDTLEEDTFHFQSDNMTARRSGQPQQGGDPTSKQK* |
Ga0137404_115232472 | 3300012929 | Vadose Zone Soil | MSEEDLEVLIAMDDPGEDTLEEDTFHRQPENLAARQSSQPQQSGDLTNKQK* |
Ga0137404_116310881 | 3300012929 | Vadose Zone Soil | MSEEDVELLITMDEPGEDTLEEDTFHLQSDHMTARRSGQPQQGGDPTSKQK* |
Ga0137404_117753231 | 3300012929 | Vadose Zone Soil | LELLITMDDPGEDTLEEDTFHLQSDNMTATRSGQPQQGGDPTSKQK* |
Ga0153915_109997071 | 3300012931 | Freshwater Wetlands | MSEEDLELLIAMDDPGKDTLEEDTFHLQADNTTARRSGQPQQGGDPTSKQK* |
Ga0162651_1000400782 | 3300012938 | Soil | MSEEDLEVLIAMDDPGEDTLEEDTFHLQTDNLTARRPDQPQQGGDPTSKQK* |
Ga0137410_101385521 | 3300012944 | Vadose Zone Soil | MSEEDLEVLIAMDDPGEDTLEEDTFHLQADNLTARQSSQPQQGGDPTSKQK* |
Ga0137410_110688201 | 3300012944 | Vadose Zone Soil | MSQEDLELRITMDDPGEDTLEEDTFHLQSDNVPGSRSGQPQQAGDPTSKQK* |
Ga0137410_118168342 | 3300012944 | Vadose Zone Soil | MSQEDLELLITMDDPGEDTLEEDTFHLQSDNVTGSRSGQPQQGGDPTSKQK* |
Ga0126375_107565492 | 3300012948 | Tropical Forest Soil | MSEEALELLITMDDPGEDTLEEDTFHLRADNTTARRSGQPQQGGDPTNKQK* |
Ga0126375_108062632 | 3300012948 | Tropical Forest Soil | MSEEDLELLITTDDPGEDTLEEDTFHLKADSTIAHQPQQGGDPTGKQK* |
Ga0126375_120421852 | 3300012948 | Tropical Forest Soil | SEVQMSEEDLELLITTDDPGEDTLEEDRFHLQPDNTTTRPGGLNEVATPTGKPE* |
Ga0157371_112637162 | 3300013102 | Corn Rhizosphere | MCEEELEVLITLDDPGEDTLEEDTFHLRSDNMTARPSGQPQQGGDPTSKQK* |
Ga0157378_116574842 | 3300013297 | Miscanthus Rhizosphere | DPGEDTLEEDTFHQAGNTTARRSGQPQQGSDPTSKQE* |
Ga0157378_117224511 | 3300013297 | Miscanthus Rhizosphere | MSFALEVPMSEEDLEVLITLDDEEDPEKEDTFHNLDNGVAHWPGQPQQGGDPTKKK* |
Ga0163162_130943122 | 3300013306 | Switchgrass Rhizosphere | MSEEDLEVLITTDDPGEDTLEEDTFHLQADHTTARRSGQSQQGGDLTSEQK* |
Ga0163162_132118151 | 3300013306 | Switchgrass Rhizosphere | MSEEDLEILVTIDDPGEDTLEEDTFHLQADNTIVQPQRAGDPASKQK* |
Ga0157372_110882253 | 3300013307 | Corn Rhizosphere | MSEEAQELLITMDDPGEDTLEEDTFHIQSDNTTARRSGQPQQVGDLTTK |
Ga0157372_115444913 | 3300013307 | Corn Rhizosphere | MSEEDLELLITTDDPGEDTLEEDHFHLQADNTARVGPVSLNEVATPTSKQK* |
Ga0120183_10032832 | 3300013754 | Terrestrial | MSEEDLELLITTDDPGEDTLEEDTFHLQADNATAPRFGQPQGGDPTSKQK* |
Ga0157380_111944472 | 3300014326 | Switchgrass Rhizosphere | MSEEDLEVLITTDDPGEDTLEEDTFHLQPDNLTARQSSQPQQGSESTSKQK* |
Ga0157380_113762632 | 3300014326 | Switchgrass Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNTTTRRSGEPQQGGDPASKQK* |
Ga0157380_116911292 | 3300014326 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDTLEEDTFHLQSDSLTGQPQQGGRPTSKQGHS* |
Ga0157377_103849201 | 3300014745 | Miscanthus Rhizosphere | MSEEDLELMITTDDPGEDSLEEDTFHLQADNTTACGYGQPQPGGDPTSKQK* |
Ga0120193_100023632 | 3300014965 | Terrestrial | MREEDVELLITMDDPGEDTLEEDTFHQADKATGHRSGQPPQDRDPTRQN* |
Ga0137418_110449902 | 3300015241 | Vadose Zone Soil | MSEEDLELLITTDDPGEDTLEEDTFHLQADNTTTRRSGQPQQGGDPTTTQK* |
Ga0137409_102434303 | 3300015245 | Vadose Zone Soil | IQMSEEDLEVLIAMDDPGEDTLEEDTFHLQADNLTARQSSQPQQGGDPTSKQK* |
Ga0132258_136634832 | 3300015371 | Arabidopsis Rhizosphere | MLFALEVHMNEEDLEVLITLDDPEDLEKEDTFHSLEADNALAHLPGQPQQGGDPTKKK* |
Ga0132256_1008836452 | 3300015372 | Arabidopsis Rhizosphere | MSEEDLEVLITLDDEEDPEKEDTFHNPDNGMAHWPGQPQHGGDPTKKK* |
Ga0132257_1001682654 | 3300015373 | Arabidopsis Rhizosphere | MSEEDLEVLITLDDEEDPEKEDTFHNPDNAVAHWPGQPQQGGDPTKKK* |
Ga0184604_101073072 | 3300018000 | Groundwater Sediment | MSEEDLEVLITTDDPGEDTLEEDTFHLQSDNTTARRSGQPQQGGDPTSKQR |
Ga0184621_100975061 | 3300018054 | Groundwater Sediment | MSEEDLEVLITLDDPGEDTLEEDTFHLQGDNTTTRRSGQPQEGGDPASKPK |
Ga0184619_104716491 | 3300018061 | Groundwater Sediment | MSEEDLELLITLDDPEDPEKEDTFHHLQADNTVAHRPGEPQQGGDPTSKQKYC |
Ga0184618_102510862 | 3300018071 | Groundwater Sediment | MSEEDLELLITLDDPGEDALEEDTFHHIQADNTVAHRPGQPQQGGDPTNKQN |
Ga0184629_102856192 | 3300018084 | Groundwater Sediment | MSEEDLEVLITLDDPEDPEKEDTFHHLEADNTVAHRPGQPQQEGDLTSNQ |
Ga0190272_100213861 | 3300018429 | Soil | MSEEDLEVLITMDDPGEDALEEDTFDHSQVGNALHTGPVGRSHQADDPTGEQK |
Ga0066662_116224451 | 3300018468 | Grasslands Soil | MSQENLELLVTMDDPGEDTLEEDTFHLQSDDMTARRSGQPQEGGDPASKLK |
Ga0190270_105951792 | 3300018469 | Soil | MSEEDLELLITTDDPGEDTLEEDTFHLKADNKTAGRSGQPQQSSDPTNVLSPASTSSGLC |
Ga0190274_129511772 | 3300018476 | Soil | MSEEDLEVLITLDDPGEDTLEEDTFHLQSDNSVAHRPGEPQQGGGPTDQSRS |
Ga0187894_100255044 | 3300019360 | Microbial Mat On Rocks | MSEEDLELLITTDDPGEDNLEEDTFHLQPDNITAPRSGQSKIGDPTSKEKV |
Ga0187894_101447442 | 3300019360 | Microbial Mat On Rocks | MSEEDLEVLITTDDPGEDTLEEDTFHLQSDNLTVPRSDQSQGGDPTSKEK |
Ga0187893_1001252813 | 3300019487 | Microbial Mat On Rocks | MSEEDLEVLITLDDPGEDTLEEDTFHQPDNTVTHRSGQSQREEPPSKQK |
Ga0193725_10953461 | 3300019883 | Soil | MSEEDLEVLITLDDPGEDSLEEDTFHHLQTDNTVGHRPGQPQQRGDPTSKQK |
Ga0193755_12161722 | 3300020004 | Soil | MIEEDLEVLIALDDPEDPEKEDTFHHSQADNTVAHWPEPQQVSDLTSKQK |
Ga0222623_101441122 | 3300022694 | Groundwater Sediment | MGEEDLEVLITLDDPEDPEKEDTFHLQADNTVAHRPGQPQQGDDPTG |
Ga0209751_100990732 | 3300025327 | Soil | MSEEDLELLITLDDPEDLEKEDTFHDLQADNTVAHRRGQPQQGGDPTSKQK |
Ga0207642_100019855 | 3300025899 | Miscanthus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHLKVDKTTSGRSGQPQQGGDPASKNK |
Ga0207710_107420432 | 3300025900 | Switchgrass Rhizosphere | MSEEEMELLITTDDPGEDTLEEDTFHLQSDSMTGQPQQGGRPTSKQGHS |
Ga0207645_103670161 | 3300025907 | Miscanthus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNATARGSGEPQQGSDPTSKQR |
Ga0207645_106339612 | 3300025907 | Miscanthus Rhizosphere | MSEEDVELLVTMDDPGEDTLEEDTFHLQADNTTARWSGQPQRGGDPTSKQK |
Ga0207643_100580423 | 3300025908 | Miscanthus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDTFHLQADNTTARRSGQPQQGGARSANRSNP |
Ga0207643_103761882 | 3300025908 | Miscanthus Rhizosphere | MSEEDLELLITTDDPGEDSLEEDTFHLHADNTTNRRSGQPQQVGDPTSKKK |
Ga0207684_100218143 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEADLELLITLDDPEDPEKEDTFHHLQADNAVADWPGQPQQGGDATSKQK |
Ga0207684_104608723 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENLELLITMDDPGEDTLEEDTFHLQADNMTARRSGQPQQGGEPTSKKK |
Ga0207684_107290042 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDTFHQADNATARRSGQPQQGGESTSQQK |
Ga0207654_102007412 | 3300025911 | Corn Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNTITPRSGQPQQGGEPNSKQK |
Ga0207654_102517673 | 3300025911 | Corn Rhizosphere | MSEEAQELLITMDDPGEDTLEEDTFHIQSDNTTARRSGQPQQVGDLTTKQK |
Ga0207654_111944681 | 3300025911 | Corn Rhizosphere | MSEEDLEVLITLDDPEDPDKEDTFHNLVADNVVAHRPGQPQQGGDPTKKE |
Ga0207662_101816013 | 3300025918 | Switchgrass Rhizosphere | MNEEDLELLITLDDPGEDALEEDTFHLRSDNMTARRPGQPQQGGDPTSKQK |
Ga0207662_101934722 | 3300025918 | Switchgrass Rhizosphere | DPGEDTLEEDTFHQAGNTITPRSGQPQQGGEPNSKQK |
Ga0207646_101500753 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQADNATARRSGQPQQGGDPTSKQK |
Ga0207646_107145592 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDTFHLQADNTTARRSGQPQQGGDPTSKQK |
Ga0207646_112433432 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEDLELLITLDDPEDPEKEDTFHYLQADNAVADWPGQPQQGGDPTSKQK |
Ga0207650_100455647 | 3300025925 | Switchgrass Rhizosphere | MSEEGLELLIAMDDPGEDTLEEDTFHLQADNTTARRSGQPQQ |
Ga0207650_111576332 | 3300025925 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDSLDEDTFHQGDNATARPSSQAQQGGDGIGKQK |
Ga0207659_117172281 | 3300025926 | Miscanthus Rhizosphere | MSEEDLELLVTIDDPGEDTLEEDTFHLQSDNMTGQPQQGGRPTSKQGHS |
Ga0207686_100993802 | 3300025934 | Miscanthus Rhizosphere | MSEEDLELLVTLDDPGEDTLEEDTFHHLQADDTLADWPGQPQQGGDPISKQK |
Ga0207686_109947142 | 3300025934 | Miscanthus Rhizosphere | MSEEAQELLITMDDPGEDTLEEDTFHLKVDKTTSGRSGQPQQGGDPASKNK |
Ga0207686_110857141 | 3300025934 | Miscanthus Rhizosphere | MSEEDLEVLITLDDEEDPEKEDTFHNLDNGVAHWPGQPQQGGDPTKKK |
Ga0207709_111370212 | 3300025935 | Miscanthus Rhizosphere | MSEEDLEVLITLDDEEDPEKEDTFHNLDNGVAHWPGQPQQG |
Ga0207669_103303821 | 3300025937 | Miscanthus Rhizosphere | TTDDPGEDALEEDTFHLRSDNMTARRSGQPQQGGDPASKNK |
Ga0207704_107645352 | 3300025938 | Miscanthus Rhizosphere | DPGEDALEEDTFHLRSDNMTARRSGQPQQDGDPTSKQK |
Ga0207665_103547002 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENLEVLITLDDPGEDNLEEDTCHQAGNATARGSGQPQQGGDPTSRQE |
Ga0207711_104091513 | 3300025941 | Switchgrass Rhizosphere | VSEEDLEVLITLDDPGEDTLEEDTFHLRTDKTTASRSGQPQQGGDPASKKK |
Ga0207689_107459882 | 3300025942 | Miscanthus Rhizosphere | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNAPARRSGQPQQGGDPTSKQE |
Ga0207667_112960061 | 3300025949 | Corn Rhizosphere | MSEEDLEVLITLDDEEDPEKEDTFHNPDNGMAHWPGQPQQGGDPTKKK |
Ga0207651_117741982 | 3300025960 | Switchgrass Rhizosphere | SEEDLEVLITLDDPGEDTLEEDTFHQAGNTITPRSGQPQQGGEPNSKQK |
Ga0207712_107863811 | 3300025961 | Switchgrass Rhizosphere | MSEEDLELLITTDDPGEDALEEDTFHLRSDNMTARRSGQPQQGGDPTSKQK |
Ga0207703_108684982 | 3300026035 | Switchgrass Rhizosphere | MSEEDLEILITIDDPGEDTLEEDTFHLQSDSLTGQPQQGGRPTSKQGHS |
Ga0207641_101285802 | 3300026088 | Switchgrass Rhizosphere | MSEEDMELLITTDDPGEDTLEEDTFHLKADNTTAARPGQHQQGGDSTVRQT |
Ga0207641_107999171 | 3300026088 | Switchgrass Rhizosphere | MSEEDLEQLITMDDPGEDTLEEDTFHLHVDNATACQPGNSPRGESASK |
Ga0207648_102665803 | 3300026089 | Miscanthus Rhizosphere | MSEEDLEILITIDDPGEDTLEEDTFHLQADNTIVQPQRAGDPASKQK |
Ga0207648_107615062 | 3300026089 | Miscanthus Rhizosphere | MSEEDLEVLITLDDPGQDTLEEDTFHLKVDKTTSGRSGQPQQGGDPASKNK |
Ga0209240_12524021 | 3300026304 | Grasslands Soil | MSEEDVELLITMDDPGEDTLEEDTFHLQSDNMTARRSGQPQQGGDPTSKQK |
Ga0209131_10575013 | 3300026320 | Grasslands Soil | MSQEDLELLITMDDPGEDTLEEDTFHLQSDNMTASRSGQPQQGGDPTSKQK |
Ga0209648_104195782 | 3300026551 | Grasslands Soil | MSEEDLEVLITLDDPGEDTLEEDTFHLQADKTTAGRSGQPEQGGDPTSKQE |
Ga0209648_105946712 | 3300026551 | Grasslands Soil | MSQEDLELLITMDDPGEDTLEEDTFHLQSDNVTASRSGQPQQAGDPTGKQK |
Ga0209331_10663061 | 3300027603 | Forest Soil | MSEEDLELLIAMDDPGEDTLEEDTFHLQADNTPARRSGQPQQADDPTSKQK |
Ga0256865_11010922 | 3300027657 | Soil | MSEEDLELLITMDDPGEDTLEEDTFHLQADNTTARWSGQPQQGGDPTSKQK |
Ga0209814_100925762 | 3300027873 | Populus Rhizosphere | MSEEDLELLITTDDPGEDSLEEDTFHVQADNLTARRTGQPQQVGDPTSKQK |
Ga0209283_102056031 | 3300027875 | Vadose Zone Soil | MSEEDVELLITMDDPGEDTLEEDTFHLQSDNMTARRSGQPQQGGDPT |
Ga0209486_101160633 | 3300027886 | Agricultural Soil | MSEEDMELLITTDDPGEDALEEDTFHLKADNTTAGRSGQNQQGDDSTSRQK |
Ga0209488_101869693 | 3300027903 | Vadose Zone Soil | MSEENLELLITMDDPGEDTLEEDTFHLQSDNMTASRSGQSEQGGDPTSKQK |
Ga0209382_106384781 | 3300027909 | Populus Rhizosphere | AFLVLRQCLEVNMSDEDLEELITVDDPGEDTLEEDTFHQAGNTTARRSGQPQQGGDPTSKQE |
Ga0268265_102988343 | 3300028380 | Switchgrass Rhizosphere | MSEEDLELLIAMDDPGEDTLEEDTFHLQADNTTARRSGQPQQGGDPISKQK |
Ga0268265_110765141 | 3300028380 | Switchgrass Rhizosphere | MSEEDLELLITLDDPGEDTLEEDTFHLEADNPTALRSGQRQRGGDPMNKQK |
Ga0268264_108695602 | 3300028381 | Switchgrass Rhizosphere | MSEEDLEILITIDDPGEDTLEEDTFHLQADNTIAQPQRAGDPASKQK |
Ga0268264_109582971 | 3300028381 | Switchgrass Rhizosphere | MSEEGLEVLITLDDPGEDTLEEDTFHQAGNTITPRSGQPQQGGEPNSKQK |
Ga0268264_110368213 | 3300028381 | Switchgrass Rhizosphere | MSEEDLEILVTIDDPGEDTLEEDTFHLQADNTIAQPQRAGDPASKQK |
Ga0268264_120846672 | 3300028381 | Switchgrass Rhizosphere | MSEEDLEVLITIDDPGEDTLEEDTFHLHPENTILQPQPGSDPTSKQKA |
Ga0307502_100092081 | 3300031164 | Soil | DLEVLITLDDPEDPEKEDTFHHLEADNTVSHRPDQLQEASDATSKQK |
Ga0307513_110934671 | 3300031456 | Ectomycorrhiza | MSEEDLEVLITLDDPEDPEKEDTFHNVQADPGQPQQGGDLTGKPK |
Ga0310888_100044372 | 3300031538 | Soil | MSEEELELLITTDDPGEDTLEEDTFHLQADLTTARRPGQPQQVGDPTSKQK |
Ga0307469_105784942 | 3300031720 | Hardwood Forest Soil | MSEEDLEVLITLDDPGEDTLEEDTFHQAGNATARGSGQPQQGGEPIGKQK |
Ga0307468_1000172082 | 3300031740 | Hardwood Forest Soil | MSEEDLELLITLDDPEEDTLEEDTFHDLQADNTVAHRPGQPQKGGDPNSKQK |
Ga0307468_1010886132 | 3300031740 | Hardwood Forest Soil | MSEEDEELLITMDDPGEDTLEEDTFHLQSDNKTVRRSGQPQQGADPTSK |
Ga0307468_1017553231 | 3300031740 | Hardwood Forest Soil | MSEEDLEVLIAMDDPGEDTLEEDTFHLQHDNTTAPVGQPQQGGDPTSKQK |
Ga0307473_105014822 | 3300031820 | Hardwood Forest Soil | MSEEDLEVLITLDDPGEDTLEEDTFHLQADNTTAGRSGQPQQDGDPASKQK |
Ga0310900_115577701 | 3300031908 | Soil | MSEEELELLITTDDPGEDTLEEDTFHLQADLTTARRPGQPQQVGDPT |
Ga0307471_1013169691 | 3300032180 | Hardwood Forest Soil | MSEEDLELLITTDDPGEDTLEEDTFHLRSDNMTARRSGQPQQGGD |
Ga0307471_1037331662 | 3300032180 | Hardwood Forest Soil | MSEEDLELLIAMDDPGEDTLEEDSFYLQADKTTAGRSGQPQQGGEPTSKQK |
Ga0307472_1004529122 | 3300032205 | Hardwood Forest Soil | MSEENLEVLITLDDPGEDTLEEDTFHQAGNATARGSGQPQQGGEPIGKQK |
⦗Top⦘ |