Basic Information | |
---|---|
Family ID | F009419 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 318 |
Average Sequence Length | 42 residues |
Representative Sequence | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDYSSSNTCH |
Number of Associated Samples | 172 |
Number of Associated Scaffolds | 318 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 75.08 % |
% of genes near scaffold ends (potentially truncated) | 25.16 % |
% of genes from short scaffolds (< 2000 bps) | 83.33 % |
Associated GOLD sequencing projects | 146 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.654 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (38.365 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.994 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.686 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 34.29% β-sheet: 0.00% Coil/Unstructured: 65.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 318 Family Scaffolds |
---|---|---|
PF12833 | HTH_18 | 9.43 |
PF00072 | Response_reg | 4.09 |
PF13374 | TPR_10 | 1.89 |
PF00487 | FA_desaturase | 1.26 |
PF01041 | DegT_DnrJ_EryC1 | 0.63 |
PF13176 | TPR_7 | 0.63 |
PF00990 | GGDEF | 0.63 |
PF13424 | TPR_12 | 0.63 |
PF13442 | Cytochrome_CBB3 | 0.63 |
PF05685 | Uma2 | 0.63 |
PF01527 | HTH_Tnp_1 | 0.31 |
PF00132 | Hexapep | 0.31 |
PF01433 | Peptidase_M1 | 0.31 |
PF00483 | NTP_transferase | 0.31 |
PF07721 | TPR_4 | 0.31 |
PF08241 | Methyltransf_11 | 0.31 |
PF13522 | GATase_6 | 0.31 |
PF03544 | TonB_C | 0.31 |
PF01636 | APH | 0.31 |
PF04055 | Radical_SAM | 0.31 |
PF14907 | NTP_transf_5 | 0.31 |
PF00149 | Metallophos | 0.31 |
PF02511 | Thy1 | 0.31 |
COG ID | Name | Functional Category | % Frequency in 318 Family Scaffolds |
---|---|---|---|
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.26 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.26 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.63 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.63 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.63 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.63 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.63 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.63 |
COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.31 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.31 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.65 % |
Unclassified | root | N/A | 5.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002557|JGI25381J37097_1071437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
3300002558|JGI25385J37094_10084217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 978 | Open in IMG/M |
3300002560|JGI25383J37093_10042720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1488 | Open in IMG/M |
3300002560|JGI25383J37093_10044096 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300002560|JGI25383J37093_10080927 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300002561|JGI25384J37096_10079007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1193 | Open in IMG/M |
3300002561|JGI25384J37096_10095914 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1044 | Open in IMG/M |
3300002562|JGI25382J37095_10156044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 736 | Open in IMG/M |
3300002562|JGI25382J37095_10272504 | Not Available | 509 | Open in IMG/M |
3300002908|JGI25382J43887_10153675 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1166 | Open in IMG/M |
3300002914|JGI25617J43924_10128530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 887 | Open in IMG/M |
3300005166|Ga0066674_10045747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1965 | Open in IMG/M |
3300005166|Ga0066674_10101364 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1337 | Open in IMG/M |
3300005166|Ga0066674_10270703 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 802 | Open in IMG/M |
3300005167|Ga0066672_10226098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1199 | Open in IMG/M |
3300005167|Ga0066672_10300057 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1043 | Open in IMG/M |
3300005171|Ga0066677_10002650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6751 | Open in IMG/M |
3300005172|Ga0066683_10184260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1287 | Open in IMG/M |
3300005172|Ga0066683_10220675 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1172 | Open in IMG/M |
3300005172|Ga0066683_10363440 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 898 | Open in IMG/M |
3300005174|Ga0066680_10064308 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2184 | Open in IMG/M |
3300005175|Ga0066673_10184851 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300005176|Ga0066679_10004725 | All Organisms → cellular organisms → Bacteria | 6202 | Open in IMG/M |
3300005176|Ga0066679_10281705 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1077 | Open in IMG/M |
3300005176|Ga0066679_10650634 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 686 | Open in IMG/M |
3300005176|Ga0066679_10808998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 597 | Open in IMG/M |
3300005177|Ga0066690_10254541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1179 | Open in IMG/M |
3300005178|Ga0066688_10727372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 628 | Open in IMG/M |
3300005180|Ga0066685_10941096 | Not Available | 575 | Open in IMG/M |
3300005181|Ga0066678_10246002 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1155 | Open in IMG/M |
3300005187|Ga0066675_10742898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 739 | Open in IMG/M |
3300005187|Ga0066675_10856025 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 687 | Open in IMG/M |
3300005406|Ga0070703_10343847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
3300005439|Ga0070711_100000207 | All Organisms → cellular organisms → Bacteria | 31190 | Open in IMG/M |
3300005440|Ga0070705_100089750 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1911 | Open in IMG/M |
3300005440|Ga0070705_100299549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1151 | Open in IMG/M |
3300005440|Ga0070705_100300190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1150 | Open in IMG/M |
3300005440|Ga0070705_100485444 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 935 | Open in IMG/M |
3300005440|Ga0070705_100858235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 727 | Open in IMG/M |
3300005445|Ga0070708_100042740 | All Organisms → cellular organisms → Bacteria | 3980 | Open in IMG/M |
3300005446|Ga0066686_10382941 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 960 | Open in IMG/M |
3300005446|Ga0066686_11071550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
3300005447|Ga0066689_10107564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1609 | Open in IMG/M |
3300005447|Ga0066689_10381280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 881 | Open in IMG/M |
3300005447|Ga0066689_10629856 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
3300005450|Ga0066682_10465338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 803 | Open in IMG/M |
3300005451|Ga0066681_10618479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 666 | Open in IMG/M |
3300005467|Ga0070706_100181074 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1967 | Open in IMG/M |
3300005467|Ga0070706_100276429 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1567 | Open in IMG/M |
3300005467|Ga0070706_100548276 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1076 | Open in IMG/M |
3300005468|Ga0070707_100352463 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300005468|Ga0070707_102057432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
3300005471|Ga0070698_100464650 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1201 | Open in IMG/M |
3300005471|Ga0070698_101879890 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
3300005536|Ga0070697_100407460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1180 | Open in IMG/M |
3300005536|Ga0070697_102093493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
3300005540|Ga0066697_10471270 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 718 | Open in IMG/M |
3300005540|Ga0066697_10756006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
3300005546|Ga0070696_100045280 | All Organisms → cellular organisms → Bacteria | 3048 | Open in IMG/M |
3300005546|Ga0070696_101893170 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
3300005552|Ga0066701_10587796 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
3300005552|Ga0066701_10800697 | Not Available | 561 | Open in IMG/M |
3300005553|Ga0066695_10232190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1162 | Open in IMG/M |
3300005553|Ga0066695_10398133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 855 | Open in IMG/M |
3300005555|Ga0066692_10712461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 621 | Open in IMG/M |
3300005556|Ga0066707_10416024 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 874 | Open in IMG/M |
3300005556|Ga0066707_10583510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 716 | Open in IMG/M |
3300005556|Ga0066707_10872637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300005556|Ga0066707_10995325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
3300005559|Ga0066700_10115405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1779 | Open in IMG/M |
3300005559|Ga0066700_10276039 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1180 | Open in IMG/M |
3300005560|Ga0066670_10067823 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1907 | Open in IMG/M |
3300005560|Ga0066670_10744478 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 594 | Open in IMG/M |
3300005561|Ga0066699_11172241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
3300005586|Ga0066691_10173704 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300005586|Ga0066691_10257076 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1026 | Open in IMG/M |
3300005878|Ga0075297_1043036 | Not Available | 539 | Open in IMG/M |
3300005886|Ga0075286_1060812 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 542 | Open in IMG/M |
3300006032|Ga0066696_10465893 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 828 | Open in IMG/M |
3300006049|Ga0075417_10660429 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
3300006173|Ga0070716_100148022 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1507 | Open in IMG/M |
3300006755|Ga0079222_10001196 | All Organisms → cellular organisms → Bacteria | 7219 | Open in IMG/M |
3300006755|Ga0079222_10028559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2346 | Open in IMG/M |
3300006755|Ga0079222_10033655 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
3300006755|Ga0079222_10046325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1988 | Open in IMG/M |
3300006755|Ga0079222_10230986 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1144 | Open in IMG/M |
3300006794|Ga0066658_10016024 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
3300006797|Ga0066659_10435638 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300006797|Ga0066659_10605132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 890 | Open in IMG/M |
3300006797|Ga0066659_10944672 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 721 | Open in IMG/M |
3300006806|Ga0079220_11048857 | Not Available | 653 | Open in IMG/M |
3300006852|Ga0075433_10065777 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3180 | Open in IMG/M |
3300006854|Ga0075425_101465195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 771 | Open in IMG/M |
3300006854|Ga0075425_102517884 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 569 | Open in IMG/M |
3300006871|Ga0075434_102492032 | Not Available | 519 | Open in IMG/M |
3300006903|Ga0075426_10461187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 941 | Open in IMG/M |
3300007076|Ga0075435_101622058 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
3300007255|Ga0099791_10066023 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1635 | Open in IMG/M |
3300007258|Ga0099793_10171380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1034 | Open in IMG/M |
3300007265|Ga0099794_10106921 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300009012|Ga0066710_100335488 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2229 | Open in IMG/M |
3300009012|Ga0066710_100403712 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2038 | Open in IMG/M |
3300009012|Ga0066710_101112052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1222 | Open in IMG/M |
3300009012|Ga0066710_101907531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 889 | Open in IMG/M |
3300009012|Ga0066710_102036920 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 848 | Open in IMG/M |
3300009012|Ga0066710_103321118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 614 | Open in IMG/M |
3300009012|Ga0066710_103712014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
3300009038|Ga0099829_10012159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5631 | Open in IMG/M |
3300009038|Ga0099829_10065746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2736 | Open in IMG/M |
3300009038|Ga0099829_10537949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 970 | Open in IMG/M |
3300009088|Ga0099830_10011152 | All Organisms → cellular organisms → Bacteria | 5498 | Open in IMG/M |
3300009088|Ga0099830_10724370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
3300009088|Ga0099830_11111896 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 655 | Open in IMG/M |
3300009089|Ga0099828_10305013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1432 | Open in IMG/M |
3300009089|Ga0099828_10384725 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1265 | Open in IMG/M |
3300009089|Ga0099828_10974177 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 756 | Open in IMG/M |
3300009090|Ga0099827_10061893 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
3300009090|Ga0099827_11156776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 672 | Open in IMG/M |
3300009090|Ga0099827_11249125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 646 | Open in IMG/M |
3300009137|Ga0066709_101306339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1063 | Open in IMG/M |
3300009137|Ga0066709_103491490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
3300009162|Ga0075423_10696539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1072 | Open in IMG/M |
3300009162|Ga0075423_11689691 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
3300010304|Ga0134088_10372736 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 694 | Open in IMG/M |
3300010322|Ga0134084_10045580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1275 | Open in IMG/M |
3300010326|Ga0134065_10143690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 828 | Open in IMG/M |
3300010329|Ga0134111_10221991 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
3300010396|Ga0134126_10672099 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1179 | Open in IMG/M |
3300010397|Ga0134124_12654533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
3300010400|Ga0134122_10887604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 861 | Open in IMG/M |
3300010401|Ga0134121_10080451 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
3300011269|Ga0137392_10871770 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 742 | Open in IMG/M |
3300011269|Ga0137392_11161871 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 630 | Open in IMG/M |
3300011270|Ga0137391_11442754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
3300012096|Ga0137389_10061284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2878 | Open in IMG/M |
3300012189|Ga0137388_10131618 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2192 | Open in IMG/M |
3300012198|Ga0137364_10138966 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1747 | Open in IMG/M |
3300012198|Ga0137364_10146983 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1701 | Open in IMG/M |
3300012198|Ga0137364_10261625 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1280 | Open in IMG/M |
3300012198|Ga0137364_10299648 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300012198|Ga0137364_10519660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 895 | Open in IMG/M |
3300012198|Ga0137364_10608470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 823 | Open in IMG/M |
3300012199|Ga0137383_10029044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3872 | Open in IMG/M |
3300012199|Ga0137383_10053257 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2896 | Open in IMG/M |
3300012199|Ga0137383_10134504 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1806 | Open in IMG/M |
3300012199|Ga0137383_10288427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1202 | Open in IMG/M |
3300012199|Ga0137383_10292476 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1193 | Open in IMG/M |
3300012199|Ga0137383_10461984 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 930 | Open in IMG/M |
3300012199|Ga0137383_10487961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 902 | Open in IMG/M |
3300012200|Ga0137382_10587222 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 795 | Open in IMG/M |
3300012200|Ga0137382_10587763 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 795 | Open in IMG/M |
3300012201|Ga0137365_10514087 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 880 | Open in IMG/M |
3300012201|Ga0137365_10517145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 877 | Open in IMG/M |
3300012201|Ga0137365_10882176 | Not Available | 653 | Open in IMG/M |
3300012203|Ga0137399_10412289 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1128 | Open in IMG/M |
3300012203|Ga0137399_10476953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1045 | Open in IMG/M |
3300012203|Ga0137399_11089451 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 672 | Open in IMG/M |
3300012204|Ga0137374_10014699 | All Organisms → cellular organisms → Bacteria | 9048 | Open in IMG/M |
3300012206|Ga0137380_10424998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1177 | Open in IMG/M |
3300012206|Ga0137380_10834210 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 794 | Open in IMG/M |
3300012207|Ga0137381_10482619 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300012207|Ga0137381_10520240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1038 | Open in IMG/M |
3300012207|Ga0137381_10699093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 881 | Open in IMG/M |
3300012207|Ga0137381_10839038 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 796 | Open in IMG/M |
3300012207|Ga0137381_11524828 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
3300012208|Ga0137376_10230246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1606 | Open in IMG/M |
3300012208|Ga0137376_10258023 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1512 | Open in IMG/M |
3300012208|Ga0137376_10395436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1200 | Open in IMG/M |
3300012208|Ga0137376_10451014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1116 | Open in IMG/M |
3300012208|Ga0137376_10461538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1102 | Open in IMG/M |
3300012208|Ga0137376_10528933 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1022 | Open in IMG/M |
3300012208|Ga0137376_10551460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 999 | Open in IMG/M |
3300012208|Ga0137376_10619103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 936 | Open in IMG/M |
3300012208|Ga0137376_11113943 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
3300012208|Ga0137376_11325253 | Not Available | 610 | Open in IMG/M |
3300012209|Ga0137379_11727623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
3300012210|Ga0137378_10068251 | All Organisms → cellular organisms → Bacteria | 3224 | Open in IMG/M |
3300012210|Ga0137378_10170358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2022 | Open in IMG/M |
3300012210|Ga0137378_10447496 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1196 | Open in IMG/M |
3300012211|Ga0137377_10457093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1215 | Open in IMG/M |
3300012211|Ga0137377_10831930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 856 | Open in IMG/M |
3300012285|Ga0137370_10459149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 776 | Open in IMG/M |
3300012285|Ga0137370_10631445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
3300012285|Ga0137370_10649326 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 655 | Open in IMG/M |
3300012285|Ga0137370_10889196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
3300012285|Ga0137370_10927398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
3300012354|Ga0137366_10203696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1477 | Open in IMG/M |
3300012356|Ga0137371_10865465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 687 | Open in IMG/M |
3300012357|Ga0137384_10409318 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1119 | Open in IMG/M |
3300012359|Ga0137385_10569055 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300012361|Ga0137360_10699381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 870 | Open in IMG/M |
3300012363|Ga0137390_10636530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1032 | Open in IMG/M |
3300012363|Ga0137390_10840263 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 875 | Open in IMG/M |
3300012376|Ga0134032_1188404 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
3300012582|Ga0137358_10229501 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1265 | Open in IMG/M |
3300012582|Ga0137358_10951861 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
3300012683|Ga0137398_10480669 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 852 | Open in IMG/M |
3300012683|Ga0137398_10659929 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
3300012685|Ga0137397_10186856 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1540 | Open in IMG/M |
3300012917|Ga0137395_10113428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1816 | Open in IMG/M |
3300012918|Ga0137396_10133482 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1798 | Open in IMG/M |
3300012918|Ga0137396_10176592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1564 | Open in IMG/M |
3300012918|Ga0137396_10375865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1053 | Open in IMG/M |
3300012918|Ga0137396_10509310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 892 | Open in IMG/M |
3300012922|Ga0137394_10416461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1145 | Open in IMG/M |
3300012922|Ga0137394_11595970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
3300012925|Ga0137419_10038451 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2997 | Open in IMG/M |
3300012925|Ga0137419_10502380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 963 | Open in IMG/M |
3300012925|Ga0137419_10543916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 927 | Open in IMG/M |
3300012925|Ga0137419_10801565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 770 | Open in IMG/M |
3300012925|Ga0137419_11040855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
3300012927|Ga0137416_12040401 | Not Available | 526 | Open in IMG/M |
3300012929|Ga0137404_10480717 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1106 | Open in IMG/M |
3300012929|Ga0137404_11491592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 626 | Open in IMG/M |
3300012930|Ga0137407_10185744 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1857 | Open in IMG/M |
3300012931|Ga0153915_10530153 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300012972|Ga0134077_10349555 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 630 | Open in IMG/M |
3300012975|Ga0134110_10181714 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 877 | Open in IMG/M |
3300012976|Ga0134076_10462206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
3300014150|Ga0134081_10094182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 937 | Open in IMG/M |
3300014157|Ga0134078_10636135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
3300015053|Ga0137405_1304209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1195 | Open in IMG/M |
3300015053|Ga0137405_1315455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2133 | Open in IMG/M |
3300015054|Ga0137420_1160129 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1626 | Open in IMG/M |
3300015054|Ga0137420_1199619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1405 | Open in IMG/M |
3300015054|Ga0137420_1372723 | All Organisms → cellular organisms → Bacteria | 5041 | Open in IMG/M |
3300015241|Ga0137418_10002272 | All Organisms → cellular organisms → Bacteria | 17607 | Open in IMG/M |
3300015241|Ga0137418_10204137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1706 | Open in IMG/M |
3300015241|Ga0137418_10430717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1070 | Open in IMG/M |
3300015245|Ga0137409_10468720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1081 | Open in IMG/M |
3300015264|Ga0137403_10324719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1430 | Open in IMG/M |
3300015359|Ga0134085_10124089 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1084 | Open in IMG/M |
3300015371|Ga0132258_11064977 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2044 | Open in IMG/M |
3300017654|Ga0134069_1205889 | Not Available | 673 | Open in IMG/M |
3300017659|Ga0134083_10009171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3273 | Open in IMG/M |
3300017659|Ga0134083_10283378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 700 | Open in IMG/M |
3300017659|Ga0134083_10605690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
3300018027|Ga0184605_10002677 | All Organisms → cellular organisms → Bacteria | 6054 | Open in IMG/M |
3300018071|Ga0184618_10027088 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1938 | Open in IMG/M |
3300018071|Ga0184618_10100341 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1134 | Open in IMG/M |
3300018431|Ga0066655_10026951 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2753 | Open in IMG/M |
3300018431|Ga0066655_10979915 | Not Available | 583 | Open in IMG/M |
3300018433|Ga0066667_10054327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2438 | Open in IMG/M |
3300018433|Ga0066667_10327511 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1206 | Open in IMG/M |
3300018433|Ga0066667_11067218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 698 | Open in IMG/M |
3300018468|Ga0066662_10164679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1699 | Open in IMG/M |
3300018468|Ga0066662_10175135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1660 | Open in IMG/M |
3300018468|Ga0066662_11460468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 710 | Open in IMG/M |
3300018468|Ga0066662_12417136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300018482|Ga0066669_10535103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1019 | Open in IMG/M |
3300018482|Ga0066669_12269182 | Not Available | 517 | Open in IMG/M |
3300019789|Ga0137408_1357315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2024 | Open in IMG/M |
3300019868|Ga0193720_1058374 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
3300020004|Ga0193755_1008595 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3331 | Open in IMG/M |
3300020004|Ga0193755_1068198 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1151 | Open in IMG/M |
3300020004|Ga0193755_1210204 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 548 | Open in IMG/M |
3300021086|Ga0179596_10179849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1021 | Open in IMG/M |
3300021307|Ga0179585_1104764 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
3300022531|Ga0242660_1132272 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 639 | Open in IMG/M |
3300024182|Ga0247669_1000102 | All Organisms → cellular organisms → Bacteria | 46233 | Open in IMG/M |
3300024330|Ga0137417_1385480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2800 | Open in IMG/M |
3300025885|Ga0207653_10110689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 980 | Open in IMG/M |
3300025910|Ga0207684_10251340 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1525 | Open in IMG/M |
3300025910|Ga0207684_10300738 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1383 | Open in IMG/M |
3300025910|Ga0207684_10341855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1289 | Open in IMG/M |
3300025910|Ga0207684_10466969 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1083 | Open in IMG/M |
3300026295|Ga0209234_1069486 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1339 | Open in IMG/M |
3300026296|Ga0209235_1067710 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1640 | Open in IMG/M |
3300026296|Ga0209235_1073603 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1548 | Open in IMG/M |
3300026296|Ga0209235_1204852 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 670 | Open in IMG/M |
3300026297|Ga0209237_1076668 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1549 | Open in IMG/M |
3300026297|Ga0209237_1111184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1178 | Open in IMG/M |
3300026297|Ga0209237_1199617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 644 | Open in IMG/M |
3300026298|Ga0209236_1188245 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 799 | Open in IMG/M |
3300026298|Ga0209236_1199847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 759 | Open in IMG/M |
3300026301|Ga0209238_1088619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1065 | Open in IMG/M |
3300026306|Ga0209468_1029305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1930 | Open in IMG/M |
3300026310|Ga0209239_1124597 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1064 | Open in IMG/M |
3300026310|Ga0209239_1161589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 872 | Open in IMG/M |
3300026310|Ga0209239_1197671 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 729 | Open in IMG/M |
3300026313|Ga0209761_1027043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3494 | Open in IMG/M |
3300026313|Ga0209761_1042489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2616 | Open in IMG/M |
3300026314|Ga0209268_1058087 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1206 | Open in IMG/M |
3300026318|Ga0209471_1120251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1118 | Open in IMG/M |
3300026326|Ga0209801_1112082 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1173 | Open in IMG/M |
3300026333|Ga0209158_1239707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
3300026342|Ga0209057_1104457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1123 | Open in IMG/M |
3300026536|Ga0209058_1315749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
3300026537|Ga0209157_1221242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 779 | Open in IMG/M |
3300026538|Ga0209056_10055838 | All Organisms → cellular organisms → Bacteria | 3495 | Open in IMG/M |
3300026547|Ga0209156_10314424 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 703 | Open in IMG/M |
3300027388|Ga0208995_1083015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
3300027748|Ga0209689_1133961 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300027787|Ga0209074_10001211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5055 | Open in IMG/M |
3300027787|Ga0209074_10005698 | All Organisms → cellular organisms → Bacteria | 2864 | Open in IMG/M |
3300027846|Ga0209180_10006223 | All Organisms → cellular organisms → Bacteria | 6042 | Open in IMG/M |
3300027846|Ga0209180_10408013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
3300027846|Ga0209180_10629950 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
3300027846|Ga0209180_10652442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
3300027862|Ga0209701_10051268 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2647 | Open in IMG/M |
3300027862|Ga0209701_10271672 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 983 | Open in IMG/M |
3300027882|Ga0209590_10131867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1531 | Open in IMG/M |
3300027903|Ga0209488_10142052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1812 | Open in IMG/M |
3300028536|Ga0137415_10330404 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1328 | Open in IMG/M |
3300028536|Ga0137415_10573456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 938 | Open in IMG/M |
3300031152|Ga0307501_10114145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 698 | Open in IMG/M |
3300031720|Ga0307469_10000619 | All Organisms → cellular organisms → Bacteria | 13005 | Open in IMG/M |
3300031962|Ga0307479_10043393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4316 | Open in IMG/M |
3300032180|Ga0307471_100178800 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2090 | Open in IMG/M |
3300032180|Ga0307471_103624454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
3300032205|Ga0307472_100162319 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1649 | Open in IMG/M |
3300032205|Ga0307472_100416115 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1130 | Open in IMG/M |
3300032205|Ga0307472_102078930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 38.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.18% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.57% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.26% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.63% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.63% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.31% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.31% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.31% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10714371 | 3300002557 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPCDVNSGNVCK* |
JGI25385J37094_100842171 | 3300002558 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPTCDYSGPNVCK* |
JGI25383J37093_100427202 | 3300002560 | Grasslands Soil | MSRSIRILLAVFVVSLALGVSACADSTAPHPACDYTSSNTCR* |
JGI25383J37093_100440963 | 3300002560 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPTCDYNGPNVCK* |
JGI25383J37093_100809272 | 3300002560 | Grasslands Soil | MSRSIRILLAVFVVSLALGVSACADTTGPSHGCDYSSSNTCH* |
JGI25384J37096_100790071 | 3300002561 | Grasslands Soil | MSRSIRILLAVFVVSLALGVSACADTTGPSHGCDYSSSNTC |
JGI25384J37096_100959142 | 3300002561 | Grasslands Soil | RGGSMSRSIRILVAVFVVSLALGASACADSTAPHPACDYNSGNVCK* |
JGI25382J37095_101560442 | 3300002562 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDWTSSNTCH* |
JGI25382J37095_102725042 | 3300002562 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDYNNGNVCK* |
JGI25382J43887_101536751 | 3300002908 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYNGSNTCK* |
JGI25617J43924_101285302 | 3300002914 | Grasslands Soil | MSRSIRTLLALLVVSFALAASACADATGPSHAACDYNNGNVCH* |
Ga0066674_100457472 | 3300005166 | Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDYTSSNTCR* |
Ga0066674_101013641 | 3300005166 | Soil | MSRSIRILLAVFVVSLALGASACADTTAPHPTCDYNGPNVCK* |
Ga0066674_102707032 | 3300005166 | Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDYVGSNTCH* |
Ga0066672_102260981 | 3300005167 | Soil | GGFMSRSIRILLAVIVVSFAFGASACADATGPSHGCDYSGPNVCH* |
Ga0066672_103000571 | 3300005167 | Soil | SMSRSIRILLAVFVVSLALGASACADSTAPHPTCDYSGPNVCK* |
Ga0066677_100026502 | 3300005171 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYVGSNTCH* |
Ga0066683_101842601 | 3300005172 | Soil | SMSRSIRILLAVFVVSLALGASACADSTAPHPACDYTSSNTCR* |
Ga0066683_102206751 | 3300005172 | Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYNNGNVCK* |
Ga0066683_103634402 | 3300005172 | Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDYLGSNTCH* |
Ga0066680_100643082 | 3300005174 | Soil | MSRTIRTLIALLVVSFALGASACADATGPQHGCDYSNSNTCH* |
Ga0066673_101848512 | 3300005175 | Soil | MSRSIRILLAVIVVSFALGASACADATGPQHGCDYSNSNTCK* |
Ga0066679_100047252 | 3300005176 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYNGSNTCK* |
Ga0066679_102817052 | 3300005176 | Soil | SMSRSIRILLAVFVVSLALGASACADSTAPHPCDVNSGNVCK* |
Ga0066679_106506341 | 3300005176 | Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDYSGPNVCH* |
Ga0066679_108089981 | 3300005176 | Soil | MSRSIRILLAVIVVSFALGASACADATGPAHGCDYNSSNTCH* |
Ga0066690_102545412 | 3300005177 | Soil | FMSRSIRILLAVIVVSFALGASACADATGPSHGCDYSGPNVCH* |
Ga0066688_107273721 | 3300005178 | Soil | MSRSIRILVAVIVVSFALGASACADATGPSHACDYSSANVCH* |
Ga0066684_102797341 | 3300005179 | Soil | SCGGLMSRSIRMLVAVLVLSVAFGLSACADSTAPHPACDYSNGNVCK* |
Ga0066685_109410962 | 3300005180 | Soil | MSRSIRILLAVIVVSFALGASACADATGPQHGCDYSGSNTCK* |
Ga0066678_102460021 | 3300005181 | Soil | ALGGFMSRTIRTLIALLVVSFALGASACADATGPQHGCDWSNSNTCH* |
Ga0066675_107428982 | 3300005187 | Soil | MSRSIRILVAVIVVSLALGASACADATGPSHLCDYTSSNTCH* |
Ga0066675_108560252 | 3300005187 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYSGSNTCH* |
Ga0070703_103438472 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYNGSNTCH* |
Ga0070711_1000002077 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRTIRTLVALLVVSFALGASACADATGPQPHGCDYVGSNTCH* |
Ga0070705_1000897502 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDYVGSNTCH* |
Ga0070705_1002995492 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDWNSSNTCH* |
Ga0070705_1003001902 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVLVVSLAFGASACADSTGPSHGCDVSGPNICH* |
Ga0070705_1004854441 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SMSRSIRILLAVFVVSLALGASACADSTAPHPACDWNSSNTCH* |
Ga0070705_1008582352 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRTIRTLIALLVVSFALGASACADATGPQHGCDYNSSNTCH* |
Ga0070708_1000427403 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDYTGSNTCH* |
Ga0066686_103829412 | 3300005446 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHACDYSSANVCH* |
Ga0066686_110715501 | 3300005446 | Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYNSSNTCK* |
Ga0066689_101075643 | 3300005447 | Soil | MSRSIRILLAVIVVSLALGTSACADATGPQHACDYSSANVCH* |
Ga0066689_103812801 | 3300005447 | Soil | MSRSIRFFLAVLLVSFALGASACADSTAPRPACDWSNGNVCH* |
Ga0066689_106298562 | 3300005447 | Soil | SIRILLAVFVVSLAFGASACADSTGPSHGCDYTSSNTCH* |
Ga0066682_104653381 | 3300005450 | Soil | MSRSIRILLAVIVVSLALGASACADATGPSHACDWTSSNTCH* |
Ga0066681_106184792 | 3300005451 | Soil | MSRSIRILLAVIVVSLALGASACADATGPSHACDYTSSNTCH* |
Ga0070706_1001810742 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAALVVSLALGASACADSTGPSHGCDYVGSNTCH* |
Ga0070706_1002764292 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVFVVSLALGASACADTTAPHPACDWTSSNTCH* |
Ga0070706_1005482761 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRTLLAVLVVSFALGVSACADATGPSHGCDYPSSNTCH* |
Ga0070707_1003524631 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVLVVSLALGASACADSTGPQHGCDVNSGNVCH* |
Ga0070707_1020574321 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYTSSNTCH* |
Ga0070698_1004646501 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVFVVSLALGASACADTTAPHPACDYTSSNTCH* |
Ga0070698_1018798901 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLSVFVVSLALGASACADSTGPSHACDYTSSNTCK* |
Ga0070699_1007045422 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLQIPRGGSMSRSIRTLLAVLVVSFALGVSACADATGPSHGCDYTSSNTCH* |
Ga0070697_1004074602 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDWSSSNTCH* |
Ga0070697_1020934932 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRTLLAVLVVSFAFGVSACADATGPAHGCDYTSSNTCH* |
Ga0066697_104712702 | 3300005540 | Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDWSGSNTCK* |
Ga0066697_107560062 | 3300005540 | Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHGCDYNGSNTCK* |
Ga0070696_1000452803 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSIRILLAVLVVSLALGASACADSTGPSHGCDWNSSNTCH* |
Ga0070696_1018931701 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | NLRGGSMSRSIRILLAVLVVSLALGASACADSTGPSHGCDYVGSNTCH* |
Ga0066701_105877962 | 3300005552 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPQHACDWNSGNVCH* |
Ga0066701_108006972 | 3300005552 | Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPTCDYNGPNVCH* |
Ga0066695_102321902 | 3300005553 | Soil | MSRSIRILLAVFVVSLAFGASACADSTGPSHGCDYTSSNTCH* |
Ga0066695_103981332 | 3300005553 | Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDYSGSNTCK* |
Ga0066692_107124612 | 3300005555 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPHHACDYTSANVCH* |
Ga0066707_104160241 | 3300005556 | Soil | MSRSIRILLAVFVVSLALGASACADSTGPQHPCDVSSGNVCH* |
Ga0066707_105835101 | 3300005556 | Soil | MSRSIRILLAVFVVSLALGASACTDSTGPSHGCDYTQ* |
Ga0066707_108726371 | 3300005556 | Soil | GFMSRSIRILLAVIVVSLAFGVSACADATGPQHACDFTNGNVCH* |
Ga0066707_109953252 | 3300005556 | Soil | MSRTIRTLIALLVVSFALGASACADATGPQHGCDYSNSN |
Ga0066700_101154053 | 3300005559 | Soil | SIRILLAVIVVSFAFGASACADATGPSHGCDYSGPNVCH* |
Ga0066700_102760392 | 3300005559 | Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDWSSGNVCH* |
Ga0066670_100678231 | 3300005560 | Soil | KHRGGFMSRSIRILLAVIVVSLAFGASACADATGPSHGCDYVGSNTCH* |
Ga0066670_107444782 | 3300005560 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPQHACDFTNGNVCH* |
Ga0066699_111722412 | 3300005561 | Soil | GGFMSRSIRILLAVIVVSLAFGASACADATGPSHGCDYVGSNTCH* |
Ga0066691_101737041 | 3300005586 | Soil | MSRTIRTLIALLVVSFALGASACADATGPQPHGCDW |
Ga0066691_102570761 | 3300005586 | Soil | VRGGSMSRSIRILLAVFVVSLALGASACADSTAPHPTCDYSGPNVCK* |
Ga0075297_10430362 | 3300005878 | Rice Paddy Soil | MSRTLRTLLALLIVSFALGASACADATGPQHGCDYSGSNTCH* |
Ga0075286_10608122 | 3300005886 | Rice Paddy Soil | MSRTLRTLLALLIVSFALGASACADATGPQHGCDYTNSNTCH* |
Ga0066696_104658931 | 3300006032 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPQHACDYNSGNVCH* |
Ga0075417_106604292 | 3300006049 | Populus Rhizosphere | MSRSIRILLAVFVVSLALGAAACADTTAPHPACDYTSSNTCH* |
Ga0070716_1001480223 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRTIRTLIALLVVSFALGASACADATGPQPHGCDWTGSNTCH* |
Ga0079222_100011966 | 3300006755 | Agricultural Soil | MSRSIRTIRTLVALLLVSFALTAVSACADATGPTHAACDWSNGNVCH* |
Ga0079222_100285593 | 3300006755 | Agricultural Soil | MSRTIRTLIALLVVSFALGASACADATGPQHGCDTVGSNTCH* |
Ga0079222_100336552 | 3300006755 | Agricultural Soil | MSRSLRTLVALLVVSFALGASACADATGPTHGCDYVGSNTCH* |
Ga0079222_100463252 | 3300006755 | Agricultural Soil | MSRTIRTLIALLVVSFALGASACADATGPQQHGCDWTGSNTCH* |
Ga0079222_102309862 | 3300006755 | Agricultural Soil | MSRTIRTLIALLVVSFALGASACADATGPQHLCDYSNSNTCH* |
Ga0066658_100160243 | 3300006794 | Soil | MSRSIRILLAVFVLSLALGASACADSTAPHPTCDYNGPNVCH* |
Ga0066659_104356382 | 3300006797 | Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDYLGSN |
Ga0066659_106051322 | 3300006797 | Soil | GGSMSRSIRILLAVFVVSLALGASACADSTAPHPTCDYSGPNVCK* |
Ga0066659_109446721 | 3300006797 | Soil | MSRSIRILVAVIVVSLALGASACADATGPSHACDYSNTNTCH* |
Ga0079221_104702212 | 3300006804 | Agricultural Soil | SPHNFAEVCMSRTIRTLIALLVVSFALGASACADATGPQHGCDTVGSNTCH* |
Ga0079220_110488572 | 3300006806 | Agricultural Soil | MSRSIRALLAVLVVSFALGVSACADATGPSHGCDVSSGNVCH* |
Ga0075433_100657774 | 3300006852 | Populus Rhizosphere | MSRSIRILLVALVVSLAFGASACADSTGPTHGCDYSGSNTCH* |
Ga0075425_1014651952 | 3300006854 | Populus Rhizosphere | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYTSSNTCK* |
Ga0075425_1025178842 | 3300006854 | Populus Rhizosphere | SMSRSIRILLAVFVVSLALGASACADSTAPHPACDYTSSNTCH* |
Ga0075434_1024920322 | 3300006871 | Populus Rhizosphere | MSRSIRILLVALVVSLGFGASACADSTGPSHGCDYSSSNTCH* |
Ga0075426_104611871 | 3300006903 | Populus Rhizosphere | LQNARGGSMSRSIRILLAVFVVSLALGASACADSTGPSHACDYNGSNTCK* |
Ga0075435_1016220582 | 3300007076 | Populus Rhizosphere | SMSRSIRILLAVFVVSLALGAAACADTTAPHPACDYTSSNTCH* |
Ga0099791_100660231 | 3300007255 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPAHGCDYTSSNTCR* |
Ga0099793_101713802 | 3300007258 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTSPAHGCDYTSSNTCH* |
Ga0099794_101069212 | 3300007265 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADATGASHGCDWSSSNTCH* |
Ga0066710_1003354882 | 3300009012 | Grasslands Soil | MSRSIRILVAVIVVSLALGASACADATGPQHGCDYTGPNVCH |
Ga0066710_1004037124 | 3300009012 | Grasslands Soil | MSRSIRILVAVIVVSFALGASACADATGPSHACDYTSSNTCH |
Ga0066710_1011120522 | 3300009012 | Grasslands Soil | MSRSIRILLAVFVVSLAFGASACADSTGPSHGCDYTSSNTCH |
Ga0066710_1019075312 | 3300009012 | Grasslands Soil | SMSRSIRILLAVFVVSLALGASACADSTGPSHGCDYNSSNTCH |
Ga0066710_1020369202 | 3300009012 | Grasslands Soil | MSRSIRILVAVIVVSFALGASACADATGPSHGCDYVGSNTCH |
Ga0066710_1033211182 | 3300009012 | Grasslands Soil | MSRSIRILVAVIVVSFALSASACADATGPSHGCDYTGSNTCH |
Ga0066710_1037120142 | 3300009012 | Grasslands Soil | FMSRSIRILLAVIVVSLAFGASACADATGPQHACDYTSANVCH |
Ga0099829_100121593 | 3300009038 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPAHGCDYSNTNTCR* |
Ga0099829_100657464 | 3300009038 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADTTAPHPACDYNGPNVCK* |
Ga0099829_105379491 | 3300009038 | Vadose Zone Soil | GGSMSRSLRTLIAVLVVSFALGATACADSTGPTHGCDYSGSNTCR* |
Ga0099830_100111522 | 3300009088 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALAATACADATGPAHGCDYSNTNTCR* |
Ga0099830_107243702 | 3300009088 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYNSGNVCH* |
Ga0099830_111118961 | 3300009088 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACVDSTGPAHGCDYSGSNTCR* |
Ga0099828_103050133 | 3300009089 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPAHGCDYSGSNTCH* |
Ga0099828_103847252 | 3300009089 | Vadose Zone Soil | MSRSLRTLLAVLVVSFAFGVSACADSTGPAHGCDYSSSNTCH* |
Ga0099828_109741772 | 3300009089 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACVDSTGPSHGCDWSSSNTCH* |
Ga0099827_100618934 | 3300009090 | Vadose Zone Soil | MSRSIRILLAVFVMSLALGASACADSTGPSHACDYNNGNVCK* |
Ga0099827_111567761 | 3300009090 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPAHGCDYTSSNTCH* |
Ga0099827_112491252 | 3300009090 | Vadose Zone Soil | MSRSIRILLAVFVMSLALGASACADSTGPSHACDYNGSNTCK* |
Ga0066709_1013063392 | 3300009137 | Grasslands Soil | MSRSIRILLAVIVVSLAFGASACADATGPHAACDYTSANVCH* |
Ga0066709_1034914902 | 3300009137 | Grasslands Soil | MSRSIRILLAVIVVSFAFGASACADATGPSHACDVNSANVCH* |
Ga0075423_106965391 | 3300009162 | Populus Rhizosphere | GSMSRSIRILLVALVVSLGFGASACADSTGPSHGCDYSSSNTCH* |
Ga0075423_116896912 | 3300009162 | Populus Rhizosphere | RILLAVFVVSLALGASACADTTAPHPACDWTSSNTCH* |
Ga0134088_103727361 | 3300010304 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDWTSSNTCR* |
Ga0134084_100455801 | 3300010322 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTGTSHACDYNNGNVCK* |
Ga0134065_101436902 | 3300010326 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACVYTSSNTCR* |
Ga0134111_102219912 | 3300010329 | Grasslands Soil | MSRSIRILLAVIVVSLAFGVSACADATGPSHGCDYVGSNTCH* |
Ga0134126_106720991 | 3300010396 | Terrestrial Soil | RILLAVLVVSLALGASACADSTGPSHGCDWNSSNTCH* |
Ga0134124_126545331 | 3300010397 | Terrestrial Soil | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDYV |
Ga0134122_108876042 | 3300010400 | Terrestrial Soil | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDYSGSNTCH* |
Ga0134121_100804512 | 3300010401 | Terrestrial Soil | MSRTIRTLIALLVVSLALGASACADATGPQPHGCDWSNSNTCH* |
Ga0137392_108717702 | 3300011269 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADTTAPHPACDYSGPNVCK* |
Ga0137392_111618711 | 3300011269 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACVDSTGPAHGCDWSSSNTCH* |
Ga0137391_114427542 | 3300011270 | Vadose Zone Soil | SMSRSLRTLIAVLVVSFALGASACADSTGPSHGCDYNGSNTCR* |
Ga0137389_100612843 | 3300012096 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDYNGPNVCK* |
Ga0137388_101316183 | 3300012189 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPSHGCDYSSSNTCH* |
Ga0137364_101389662 | 3300012198 | Vadose Zone Soil | MSRSIRILLAVIVVSLGFGVSACADATGPSHACDYTSANVCH* |
Ga0137364_101469832 | 3300012198 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADTTAPHPACDWSSSNTCH* |
Ga0137364_102616251 | 3300012198 | Vadose Zone Soil | MSRSIRILLAVIVVSLALGASACADATGPSHACDYSSSNTCH* |
Ga0137364_102996482 | 3300012198 | Vadose Zone Soil | MSRSIRILLAVIVVSFAFGASACADATGPSHGCDWSGSNTCK* |
Ga0137364_105196603 | 3300012198 | Vadose Zone Soil | GGSMSRSIRILLAVIVVSLALGASACADATGPSHACDYTSSNTCR* |
Ga0137364_106084701 | 3300012198 | Vadose Zone Soil | QNVRGGSMSRSIRILLAVFVVSLALGASACADSTGPSHACDYNNGNVCK* |
Ga0137383_100290447 | 3300012199 | Vadose Zone Soil | MSRSIRILLAVIVVSLALGATACADATGPSHACDWSSSNTCH* |
Ga0137383_100532571 | 3300012199 | Vadose Zone Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDWTSANVCK* |
Ga0137383_101345042 | 3300012199 | Vadose Zone Soil | MSRSIRILVAVIVVSFALGASACADATGPSHACDVNSANVCH* |
Ga0137383_102884271 | 3300012199 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDYTSSNTCH* |
Ga0137383_102924761 | 3300012199 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDYNNGNVCH* |
Ga0137383_104619842 | 3300012199 | Vadose Zone Soil | MSRSIRILLAVIVVSFAFGASACADATGPSHGCDYSNSNTCH* |
Ga0137383_104879612 | 3300012199 | Vadose Zone Soil | MSRSIRILLAVIVVSFALGASACADATGPSHACDWNNSNTCK* |
Ga0137382_105872222 | 3300012200 | Vadose Zone Soil | MSRSIRILLAVIVVSFAFGASACADATGPSHGCDYSGPNVCH* |
Ga0137382_105877632 | 3300012200 | Vadose Zone Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYSNSNTCH* |
Ga0137365_105140871 | 3300012201 | Vadose Zone Soil | MSRSIRIMLAVIFVSLALGAWACADATSPSHACDYSSSNTCH* |
Ga0137365_105171451 | 3300012201 | Vadose Zone Soil | MSRSIRILLAVIVVSLALGASACADATGPSHACDYTSSNTCR* |
Ga0137365_108821762 | 3300012201 | Vadose Zone Soil | MSRSIRIMLAVIFVSLALGASACADATGPSHACDYSSSNTCH* |
Ga0137399_104122891 | 3300012203 | Vadose Zone Soil | MSRSIRILLAVLVVSFAVAASACADATGPQHACDVNGGNICH* |
Ga0137399_104769532 | 3300012203 | Vadose Zone Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDYSSSNTCK* |
Ga0137399_110894511 | 3300012203 | Vadose Zone Soil | MSRSIRILVALFVVSFALGASACADSTGPSHGCDWSNSNTCH* |
Ga0137374_100146993 | 3300012204 | Vadose Zone Soil | MSRSIRALLAVLVVSLAFGVSACADATGPSHACDYNSSNTCR* |
Ga0137380_104249981 | 3300012206 | Vadose Zone Soil | MSRSIRILLAVFVVSLVLGASACADSTGPSHACDYNSSNTCK* |
Ga0137380_108342101 | 3300012206 | Vadose Zone Soil | RSIRILLAVFVVSLALGASACADSKTPHPTCDYSGPNVCK* |
Ga0137381_104826191 | 3300012207 | Vadose Zone Soil | MSRSIRILLAVIVVSFALGASACADATGPQHGCDYSNSNTCH* |
Ga0137381_105202401 | 3300012207 | Vadose Zone Soil | SIRILLAVFVVSLALGASACADSTGPSHACDYNNGNVCK* |
Ga0137381_106990932 | 3300012207 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADTTAPHPACDYNNGNVCH* |
Ga0137381_108390382 | 3300012207 | Vadose Zone Soil | IRILVAVIVVSFALGASACADATGPQHGCDYSNSNTCK* |
Ga0137381_115248282 | 3300012207 | Vadose Zone Soil | MSRSLRTLLALLIVTFALGASACADATGPQHGCDWSGSNTCH* |
Ga0137376_102302463 | 3300012208 | Vadose Zone Soil | MSRSIRILLAVIVVSFAFGASACADATGPSHGCDYNSSNTCH* |
Ga0137376_102580232 | 3300012208 | Vadose Zone Soil | MSRSIRILLAVFFVSLALGASACADTTAPHPACDWSSSNTCH* |
Ga0137376_103954362 | 3300012208 | Vadose Zone Soil | QKRCGGSMSRSIRILLAVIVVSFAFGASACADATGPSHGCDYSNSNTCH* |
Ga0137376_104510142 | 3300012208 | Vadose Zone Soil | SMSRSIRILLAVIVVSFAFGASACADATGPSHGCDWSGSNTCH* |
Ga0137376_104615382 | 3300012208 | Vadose Zone Soil | MSRSIRILLAVIVVSFAFGASACADATGPQHGCDYSNSNTCK* |
Ga0137376_105289332 | 3300012208 | Vadose Zone Soil | MSRSIRILLAVLVVSFAVGASACADSTGPSHGCDYTGSNTCH* |
Ga0137376_105514601 | 3300012208 | Vadose Zone Soil | LQKRRGGSMSRSIRILLAVIVVSLALGASACADATGPSHACDWTSSNTCH* |
Ga0137376_106191032 | 3300012208 | Vadose Zone Soil | SRSIRILLAVIVVSLALGASACADATGPSHACDYTSSNTCR* |
Ga0137376_111139432 | 3300012208 | Vadose Zone Soil | MSRSIRILLAVIVVSFALGASACADATGPSHACDVNSANVCH* |
Ga0137376_113252532 | 3300012208 | Vadose Zone Soil | MSRSIRILLAVIVVSFALGASACADATSPSHGCDYNGSNTCH* |
Ga0137379_117276232 | 3300012209 | Vadose Zone Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDYSNSNTCH* |
Ga0137378_100682514 | 3300012210 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPTCDYNSGNVCH* |
Ga0137378_101703582 | 3300012210 | Vadose Zone Soil | MSRSIRILLAVIVVSLALGASACADATGPSHACDWSSSNTCH* |
Ga0137378_104474962 | 3300012210 | Vadose Zone Soil | MSRSLRTFLALLVVSFALGAAACADATGPQHGCDYSSSNTCR* |
Ga0137377_104570931 | 3300012211 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDWNSSNTCH* |
Ga0137377_108319302 | 3300012211 | Vadose Zone Soil | LAVIVVSFALGASACADATGPQHGCDYSNSNTCH* |
Ga0137370_104591491 | 3300012285 | Vadose Zone Soil | MSRSIRILLAVIVVSFALGASACADATGPQHGCDYSNSNTCH |
Ga0137370_106314451 | 3300012285 | Vadose Zone Soil | MSRSIRILLAVIFVSLAVAASACADATGPTHACDWSSANVCH* |
Ga0137370_106493261 | 3300012285 | Vadose Zone Soil | LAALVVSFAVAASACADATGPSHGCDYLGSNTCH* |
Ga0137370_108891961 | 3300012285 | Vadose Zone Soil | LQNVRGGSMSRSIRILLAVFVVSLALGASACADSTGPSHACDYNNGNVCK* |
Ga0137370_109273981 | 3300012285 | Vadose Zone Soil | GSMSRSIRILLAVFVVSLALGASACADSTAPHPCDVNSGNVCK* |
Ga0137366_102036963 | 3300012354 | Vadose Zone Soil | MSRSLRTFLALLVVSFALGAAACADATGPQHGCDWSSSNTCH* |
Ga0137371_108654652 | 3300012356 | Vadose Zone Soil | LAVIVVSLAFGASACADATGPSHACDYSSANVCH* |
Ga0137384_104093181 | 3300012357 | Vadose Zone Soil | RSIRILLAVIVVSLALGVSACADYTRPVHACDTNNGNVCR* |
Ga0137385_105690552 | 3300012359 | Vadose Zone Soil | MSRSIRILLAVIVVSLALGASACADATGPSHACDYTGS |
Ga0137360_106993811 | 3300012361 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPAHGCDYSSSNTCH* |
Ga0137390_106365302 | 3300012363 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADATGPSHGCDWSSSNTCH* |
Ga0137390_108402631 | 3300012363 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPTHGCDYSGSNTCR* |
Ga0134032_11884041 | 3300012376 | Grasslands Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHACDYTSANVCH* |
Ga0137358_102295012 | 3300012582 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHGCDYSSSNTCR* |
Ga0137358_109518611 | 3300012582 | Vadose Zone Soil | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDYSSSNTCH* |
Ga0137398_104806693 | 3300012683 | Vadose Zone Soil | GGFMSRSLRTLIAVLVVSFALGATACADATGPSHGCDWNSSNTCH* |
Ga0137398_106599292 | 3300012683 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADYTAPHPTCDYNGPNVCK* |
Ga0137397_101868562 | 3300012685 | Vadose Zone Soil | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDVNGGNVCH* |
Ga0137395_101134282 | 3300012917 | Vadose Zone Soil | MSRSIRILLAVFVVSLPLGASACADSTAPHPACDYNSGNVCH* |
Ga0137396_101334822 | 3300012918 | Vadose Zone Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYSSANVCH* |
Ga0137396_101765923 | 3300012918 | Vadose Zone Soil | MSRSIRILLAVIVVSLALGASACADATGPSHGCDYSSSNTCH* |
Ga0137396_103758652 | 3300012918 | Vadose Zone Soil | MSRSIRILLAVIVVSLALGASACADATGPSHGCDYSGSNTCK* |
Ga0137396_105093102 | 3300012918 | Vadose Zone Soil | MSRSIRILFAVLVVSLALGASACADSTGPSHGCVDSGSNTCH* |
Ga0137394_104164612 | 3300012922 | Vadose Zone Soil | MSRSIRILLAVLVVSLALGALACADSTGPSHGCDWSSSNTCH* |
Ga0137394_115959701 | 3300012922 | Vadose Zone Soil | MSRSIRILLALFVVSFALGASACADSTGPSHGCDWSNSNTCH* |
Ga0137419_100384514 | 3300012925 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADATGPAHGCDYSNTNTCR* |
Ga0137419_105023802 | 3300012925 | Vadose Zone Soil | MSRSIRILLAVIVVSLALGASACADATGPSHGCDYSSSNTCK* |
Ga0137419_105439161 | 3300012925 | Vadose Zone Soil | NVRGGFMSRSLRTLIAVLVVSFALGATACADSTGPSHGCDWNSSNTCH* |
Ga0137419_108015651 | 3300012925 | Vadose Zone Soil | NVRGGFMSRSLRTLIAVLVVSFALGATACADSTGPSHGCDYSNTNTCR* |
Ga0137419_110408551 | 3300012925 | Vadose Zone Soil | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDYNGSNTCH* |
Ga0137416_120404012 | 3300012927 | Vadose Zone Soil | MSRSIRILVALLVVSFALGASACADSTGPSHGCDWSSSNTCH* |
Ga0137404_104807173 | 3300012929 | Vadose Zone Soil | MSRSIRILLAVIVVSFALGASACADATGPQHACDVSSANVCH* |
Ga0137404_114915921 | 3300012929 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGVTACADSTGPAHGCDYTSSNTCR* |
Ga0137407_101857443 | 3300012930 | Vadose Zone Soil | MSRSIRILVAVFVVSLALGASACADSSTGPQHPCDVSGANVCK* |
Ga0153915_105301531 | 3300012931 | Freshwater Wetlands | MSRTLRTLLALLIVSLALGVSACADATGPQHGCDYSSSNTCH* |
Ga0134077_103495552 | 3300012972 | Grasslands Soil | MSRSIRILLAVIVVSLAFGASACADATGPQHACDYNNGNVCH* |
Ga0134110_101817141 | 3300012975 | Grasslands Soil | IRILLAVFVVSLALGASACADSTGPSHACDYNNGNVCK* |
Ga0134076_104622061 | 3300012976 | Grasslands Soil | GSMSRSIRILLAVFVVSLALGASACADSTGPSHACDYNSSNTCK* |
Ga0134081_100941822 | 3300014150 | Grasslands Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHACDYSGPNVCK* |
Ga0134078_106361352 | 3300014157 | Grasslands Soil | MSRSIRILLAVFVVSLARGASACADSTAPHPACDYTSSNTCR* |
Ga0137405_13042092 | 3300015053 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADATGPAHGCDYNGSNTCR* |
Ga0137405_13154552 | 3300015053 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHGCDWSSSNTCR* |
Ga0137420_11601292 | 3300015054 | Vadose Zone Soil | MSRSIRILLAVFVVSFALAASACADSTGPSHGCDYNSGNVCK* |
Ga0137420_11996191 | 3300015054 | Vadose Zone Soil | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDVNSGNVCH* |
Ga0137420_13727236 | 3300015054 | Vadose Zone Soil | MSGIRTLIAVLVVSFALGATACADSTGPSHGCDYSNTNTCR* |
Ga0137418_100022722 | 3300015241 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPSHGCDYSNTNTCR* |
Ga0137418_102041372 | 3300015241 | Vadose Zone Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYSGSNTCK* |
Ga0137418_104307171 | 3300015241 | Vadose Zone Soil | RSLRTLIAVLVVSFALGATACADSTGPSHGCDWNSSNTCH* |
Ga0137409_104687202 | 3300015245 | Vadose Zone Soil | MSRSIRILLALFVVSFALGASACADSTGPAHGCDYNSSNTCH* |
Ga0137403_103247191 | 3300015264 | Vadose Zone Soil | MSRSIRILLAVIVVSLALGASACADATGPSHGCDYSSANVCH* |
Ga0134085_101240891 | 3300015359 | Grasslands Soil | NIRGGSMSRSIRILLAVFVVSLALGASACADSTAPHPACDYTSSNTCR* |
Ga0132258_110649772 | 3300015371 | Arabidopsis Rhizosphere | MSRTLRTLIALLVVSFAIGASACADATGPQHGCDYSNSNTCH* |
Ga0134069_12058892 | 3300017654 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDWTSSNTCR |
Ga0134083_100091714 | 3300017659 | Grasslands Soil | MSRSIRILLAVIVVSLAFGASACADATGPQHACDYTSANVCH |
Ga0134083_102833781 | 3300017659 | Grasslands Soil | SIRILLAVFVVSLALGASACADSTGPSHACDYNHGNVCK |
Ga0134083_106056902 | 3300017659 | Grasslands Soil | FMSRTIRTLIALLVVSFALGASACADATGPQHGCDYSNSNTCH |
Ga0184605_100026778 | 3300018027 | Groundwater Sediment | MSRTIRTLLTLLVVSFALSAAACADATGPQHGCDYSNGNVCH |
Ga0184618_100270882 | 3300018071 | Groundwater Sediment | MSRTIRTLLTLLVVSFALGASACADATAPQHGCDYVGSNTCH |
Ga0184618_101003411 | 3300018071 | Groundwater Sediment | MSRTIRTLLTLLVVSFALSAAACADATGPQHGCDYNNGNVCH |
Ga0066655_100269512 | 3300018431 | Grasslands Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYVGSNTCH |
Ga0066655_109799152 | 3300018431 | Grasslands Soil | MSRSIRILLAVFVVSLALGVSACADTTGPSHGCDYSSSNTCH |
Ga0066667_100543271 | 3300018433 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDYTSSNTCR |
Ga0066667_103275111 | 3300018433 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYNNGNVCK |
Ga0066667_110672181 | 3300018433 | Grasslands Soil | MSRSIRILLAVIVVSFALGDSACVFATGPSQVIIYSGSYVCY |
Ga0066662_101646793 | 3300018468 | Grasslands Soil | MSRTIRTLIALLVVSFALGASACADATGPQHGCDYSNSNTCH |
Ga0066662_101751352 | 3300018468 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPTCDYNGPNVCK |
Ga0066662_114604682 | 3300018468 | Grasslands Soil | SRSIRILLAVIVVSFALGASACADATGPSHGCDYSGPNVCH |
Ga0066662_124171361 | 3300018468 | Grasslands Soil | MSRSIRILLAVIVVSFALGASACADATGPAHGCDYNSSNTCH |
Ga0066669_105351031 | 3300018482 | Grasslands Soil | MSRSIRILLAVIVVSFALGASACADATGPQHGCDHSNSNTCK |
Ga0066669_122691822 | 3300018482 | Grasslands Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDYSGSNTCK |
Ga0137408_13573154 | 3300019789 | Vadose Zone Soil | SMSRSIRILLAVFVVSLALGASACADSTGPSHACDYNNGNVCK |
Ga0193720_10583742 | 3300019868 | Soil | MSRTIRTLLTLLVVSFALSAAACADATGPQHGCDYSGSNTCH |
Ga0193755_10085954 | 3300020004 | Soil | MSRSIRILLAVLVVSLAFGASACADSTGPSHGCDWSNSNTCH |
Ga0193755_10681982 | 3300020004 | Soil | MSRSIRILLAVLVASLALGASACADATGPQHGCDYSNSNTCH |
Ga0193755_12102042 | 3300020004 | Soil | LLAVLVVSLAFGASACADSTGPSHGCDYTGSNTCH |
Ga0179596_101798492 | 3300021086 | Vadose Zone Soil | MSRSIRILLAVFVVSLPLGASACADSTAPHPACDYNSGNVCH |
Ga0179585_11047641 | 3300021307 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPAHGCDYSSSNTCH |
Ga0242660_11322722 | 3300022531 | Soil | MSRSIRALVAVLVVSFALAASACADATGPKHGCDVNNGNVCH |
Ga0247669_100010236 | 3300024182 | Soil | MSRTIRTLVALLVVSFALGASACADATGPQPHGCDWSSSNTCH |
Ga0137417_13854804 | 3300024330 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPSHGCDYSNTNTCH |
Ga0207653_101106892 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYNSSNTCK |
Ga0207684_102513402 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVFVVSLALGASACADSTAPHPACDWTSSNTCH |
Ga0207684_103007382 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYNGSNTCH |
Ga0207684_103418552 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAVFVVSLALGASACADSTAPHPACDWNSSNTCH |
Ga0207684_104669692 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSIRILLAALVVSLALGASACADSTGPSHGCDYVGSNTCH |
Ga0209234_10694862 | 3300026295 | Grasslands Soil | MSRSIRILLAAFVVSLALGASACADSTAPHPACDYNNGNVCK |
Ga0209235_10677102 | 3300026296 | Grasslands Soil | MSRSIRILLAVFVVSLALGVSACADSTAPHPACDYTSSNTCR |
Ga0209235_10736032 | 3300026296 | Grasslands Soil | MSRSIRILIAVLVVSLALGASACADSTGPSHGCDYSGPNVCK |
Ga0209235_12048522 | 3300026296 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDYNNGNVCK |
Ga0209237_10766682 | 3300026297 | Grasslands Soil | MSRSIHILLAVFVVSLALGASACADSTAPHPTCDYNGPNVCK |
Ga0209237_11111842 | 3300026297 | Grasslands Soil | MSRSLRTLLAVLVVSFAFGVSACADSTGPAHGCDYSSSNTCH |
Ga0209237_11996171 | 3300026297 | Grasslands Soil | MSRSIRILLAVIVVSLALGASACADATGPQHACDYNSGNVCH |
Ga0209236_11882452 | 3300026298 | Grasslands Soil | IHILLAVFVVSLALGASACADSTAPHPACDWSSGNVCH |
Ga0209236_11998471 | 3300026298 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPTCDYSGPNVCK |
Ga0209238_10886191 | 3300026301 | Grasslands Soil | GGSMLRSIRILLAVFVVSLALGASACADSTAPHPTCDYSGPNVCK |
Ga0209468_10293052 | 3300026306 | Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYNGSNTCK |
Ga0209239_11245972 | 3300026310 | Grasslands Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPTCDYNGPNVCH |
Ga0209239_11615892 | 3300026310 | Grasslands Soil | MSRSIRILLAVIVVSLALGASACADATGPSHACDYSNTNTCH |
Ga0209239_11976712 | 3300026310 | Grasslands Soil | MSRSIRILLAVFVVSLAFGASACADSTGPSHGCDYTSSNT |
Ga0209761_10270433 | 3300026313 | Grasslands Soil | MSRSIRILLAVIVVSLAFGASACADATGPHHACDYTSANVCH |
Ga0209761_10424892 | 3300026313 | Grasslands Soil | MSRSIRILVAVFVVSLALGASACADSTAPHPACDYNSGNVCK |
Ga0209268_10580871 | 3300026314 | Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPCDVNSGNVCK |
Ga0209471_11202511 | 3300026318 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYNGSNTCK |
Ga0209801_11120821 | 3300026326 | Soil | MSRSIRILLAVFVVSLALGASACADSTAPHPACDWSSGNVCH |
Ga0209473_10801551 | 3300026330 | Soil | MSRSIRMLVAVLVLSVAFGLSACADSTAPHPACDYSNGNVCK |
Ga0209158_12397072 | 3300026333 | Soil | MSRSIRILLAVIVVSFALGASACADATGPSQGCDYSGPNVCH |
Ga0209057_11044572 | 3300026342 | Soil | MSRSIRILLAVIVVSFALGASACADATGPSHGCDWSGSNTCK |
Ga0209058_13157491 | 3300026536 | Soil | MSRSIRILLAVFVVSLALGASACADSTGPSHACDYN |
Ga0209157_12212422 | 3300026537 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYVGSNTC |
Ga0209056_100558384 | 3300026538 | Soil | MSRSIRILLAVFVVSLALGASACADTTAPHPTCDYNGPNVCK |
Ga0209156_100024731 | 3300026547 | Soil | MSRTIRMLVAFVVLSFAFGLSACADATGPQHGCDYSGGNICH |
Ga0209156_103144241 | 3300026547 | Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHACDYSSANVCH |
Ga0208995_10830151 | 3300027388 | Forest Soil | MSRSIRMLVAVVVVSLAFGASACADSTGPQHGCDYNSGNVCR |
Ga0209689_11339613 | 3300027748 | Soil | IRILLAVIVVSFAFGASACADATGPSHGCDYSGPNVCH |
Ga0209074_100012116 | 3300027787 | Agricultural Soil | MSRTIRTLIALLVVSFALGASACADATGPQHGCDTVGSNTCH |
Ga0209074_100056982 | 3300027787 | Agricultural Soil | MSRTIRTLIALLVVSFALGASACADATGPQHLCDYSNSNTCH |
Ga0209180_100062231 | 3300027846 | Vadose Zone Soil | SRSLRTLIAVLVVSFALGATACADSTGPAHGCDYSNTNTCR |
Ga0209180_104080132 | 3300027846 | Vadose Zone Soil | GGSMSRSLRTLIAVLVVSFALGATACADSTGPTHGCDYSGSNTCR |
Ga0209180_106299502 | 3300027846 | Vadose Zone Soil | MSRSIRILLAVFVVSLALGASACADTTAPHPACDYNGPNVCK |
Ga0209180_106524422 | 3300027846 | Vadose Zone Soil | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDWSNSNTCH |
Ga0209701_100512683 | 3300027862 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALAATACADATGPAHGCDYSNTNTCR |
Ga0209701_102716721 | 3300027862 | Vadose Zone Soil | VHLQTPGGLMSRSIRTLLALLVVSFALAASACADATGPTHACDYNNGNVCQ |
Ga0209590_101318672 | 3300027882 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADSTGPAHGCDYSGSNTCH |
Ga0209488_101420522 | 3300027903 | Vadose Zone Soil | MSRSLRTLIAVLVVSFALGATACADATGPSHGCDWSSSNTCH |
Ga0137415_103304042 | 3300028536 | Vadose Zone Soil | MSRSIRILLAVIVVSLAFGASACADATGPSHGCDYSGSNTCK |
Ga0137415_105734562 | 3300028536 | Vadose Zone Soil | MSRSIRILLAVLVVSLALGASACADSTGPSHGCDVNSGNVCH |
Ga0307501_101141451 | 3300031152 | Soil | MSRSIRILFAVLVVSLAFGASACADATGPSHGCDWSSSNTCH |
Ga0307469_100006195 | 3300031720 | Hardwood Forest Soil | MSRTIRTLIALLVVSFAIGASACADATGPQHGCDYSNSNTCH |
Ga0307479_100433936 | 3300031962 | Hardwood Forest Soil | MSRTIRTLIALLVVSLALGASACADATGPQPHGCDWSNSNTCH |
Ga0307471_1001788002 | 3300032180 | Hardwood Forest Soil | MSRSIRILLAVLVVSLALGASACADSTGPAHGCDWNSSNTCH |
Ga0307471_1036244541 | 3300032180 | Hardwood Forest Soil | MSRTIRTLIALLVVSFALGASACADATGPQQHGCDTVGSNTCH |
Ga0307472_1001623193 | 3300032205 | Hardwood Forest Soil | MSRTIRTLIALFVVSLALGASACADATGPQHGCDYSNSNTCH |
Ga0307472_1004161152 | 3300032205 | Hardwood Forest Soil | SMSRSIRILLAVFVVSLALGASACADSTGPSHACDYNGSNTCH |
Ga0307472_1020789301 | 3300032205 | Hardwood Forest Soil | MSRTIRTLIALLVVSFALGASACADATGPQHGCDTVG |
⦗Top⦘ |