Metagenome Family F008599

Basic Information
Family ID	F008599
Family Type	Metagenome
Number of Sequences	330
Average Sequence Length	37 residues
Representative Sequence	MGLLYRKKEYPYLLVIILGDLIAYRGGIINLKIGPI
Number of Associated Samples	19
Number of Associated Scaffolds	327

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	79.88 %
% of genes near scaffold ends (potentially truncated)	11.82 %
% of genes from short scaffolds (< 2000 bps)	16.06 %
Associated GOLD sequencing projects	19
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Unclassified (55.455 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (92.424 % of family members)
Environment Ontology (ENVO)	Unclassified (94.242 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (84.848 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.44% β-sheet: 0.00% Coil/Unstructured: 51.56%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 327 Family Scaffolds
PF00078	RVT_1	0.92
PF01369	Sec7	0.31
PF01738	DLH	0.31
PF00119	ATP-synt_A	0.31
PF14636	FNIP_N	0.31
PF07727	RVT_2	0.31
PF11416	Syntaxin-5_N	0.31
PF00732	GMC_oxred_N	0.31
PF13472	Lipase_GDSL_2	0.31
PF00046	Homeodomain	0.31
PF00083	Sugar_tr	0.31
PF00735	Septin	0.31
PF05699	Dimer_Tnp_hAT	0.31
PF13857	Ank_5	0.31
PF00665	rve	0.31
PF01553	Acyltransferase	0.31
PF13551	HTH_29	0.31
PF03060	NMO	0.31

COG ID	Name	Functional Category	% Frequency in 327 Family Scaffolds
COG0356	FoF1-type ATP synthase, membrane subunit a	Energy production and conversion [C]	0.31
COG0516	IMP dehydrogenase/GMP reductase	Nucleotide transport and metabolism [F]	0.31
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.31
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.31
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.31
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.31
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.31
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.31
COG5307	Guanine-nucleotide exchange factor YEL1, contains Sec7 domain	General function prediction only [R]	0.31

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
All Organisms	root	All Organisms	44.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
cellular organisms	root	All Organisms → cellular organisms	27.88 %
Viruses	superkingdom	All Organisms → Viruses	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	27.88 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	25.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.30 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	15.15 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.30 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	12.12 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.30 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Ascomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	11.52 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Basidiomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
saccharomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta	11.52 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Agaricomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Pezizomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	11.52 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Agaricomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
leotiomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta	9.39 %
Agaricomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
dothideomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta	6.06 %
sordariomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta	2.73 %
Agaricales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Lecanoromycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Dothideomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes	6.06 %
Sordariomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes	1.52 %
Leotiomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes	1.21 %
Marasmiaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
OSLEUM clade	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Pleosporomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae	4.24 %
Hypocreomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae	1.21 %
Moniliophthora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora	0.30 %
Dothideomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Dothideomycetes incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis	0.91 %
Leotiomycetes incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis	0.61 %
Umbilicariomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Pleosporales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales	2.12 %
Pleosporomycetidae incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis	0.30 %
Hypocreales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales	0.30 %
Dothideales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Dothideales	0.30 %
Mytilinidiales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales	0.30 %
Myxotrichaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Myxotrichaceae	0.30 %
Pseudeurotiaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Pseudeurotiaceae	0.30 %
Moniliophthora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Zopfiaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae	0.91 %
Umbilicariales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae → Umbilicariales	0.61 %
Glomerellales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Glomerellales	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Gloniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis → Gloniaceae	0.30 %
Massarineae	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Massarineae	0.30 %
Saccotheciaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Dothideales → Saccotheciaceae	0.30 %
Nectriaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae	0.30 %
Pleomassariaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleomassariaceae	0.30 %
Pseudogymnoascus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Pseudeurotiaceae → Pseudogymnoascus	0.30 %
Oidiodendron	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Myxotrichaceae → Oidiodendron	0.30 %
Argynnaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales → Argynnaceae	0.30 %
Moniliophthora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Zopfia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia	0.91 %
Glomerellaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Glomerellales → Glomerellaceae	0.61 %
Umbilicariaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae → Umbilicariales → Umbilicariaceae	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Aureobasidium	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Dothideales → Saccotheciaceae → Aureobasidium	0.30 %
Fusarium	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium	0.30 %
Didymosphaeriaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Massarineae → Didymosphaeriaceae	0.30 %
Pleomassaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleomassariaceae → Pleomassaria	0.30 %
Oidiodendron maius	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Myxotrichaceae → Oidiodendron → Oidiodendron maius	0.30 %
Glonium	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis → Gloniaceae → Glonium	0.30 %
Lepidopterella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales → Argynnaceae → Lepidopterella	0.30 %
Pseudogymnoascus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Pseudeurotiaceae → Pseudogymnoascus	0.30 %
Moniliophthora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Zopfia rhizophila	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia → Zopfia rhizophila	0.91 %
Lasallia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae → Umbilicariales → Umbilicariaceae → Lasallia	0.61 %
Colletotrichum	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Glomerellales → Glomerellaceae → Colletotrichum	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Lepidopterella palustris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales → Argynnaceae → Lepidopterella → Lepidopterella palustris	0.30 %
Oidiodendron maius Zn	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Myxotrichaceae → Oidiodendron → Oidiodendron maius → Oidiodendron maius Zn	0.30 %
Glonium stellatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis → Gloniaceae → Glonium → Glonium stellatum	0.30 %
unclassified Fusarium	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → unclassified Fusarium	0.30 %
Colletotrichum destructivum species complex	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Glomerellales → Glomerellaceae → Colletotrichum → Colletotrichum destructivum species complex	0.30 %
Bimuria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Massarineae → Didymosphaeriaceae → Bimuria	0.30 %
Pleomassaria siparia	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleomassariaceae → Pleomassaria → Pleomassaria siparia	0.30 %
Aureobasidium pullulans	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Dothideales → Saccotheciaceae → Aureobasidium → Aureobasidium pullulans	0.30 %
Pseudogymnoascus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Pseudeurotiaceae → Pseudogymnoascus	0.30 %
Moniliophthora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Zopfia rhizophila CBS 207.26	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia → Zopfia rhizophila → Zopfia rhizophila CBS 207.26	0.91 %
Lasallia pustulata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae → Umbilicariales → Umbilicariaceae → Lasallia → Lasallia pustulata	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Lepidopterella palustris CBS 459.81	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales → Argynnaceae → Lepidopterella → Lepidopterella palustris → Lepidopterella palustris CBS 459.81	0.30 %
Pleomassaria siparia CBS 279.74	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleomassariaceae → Pleomassaria → Pleomassaria siparia → Pleomassaria siparia CBS 279.74	0.30 %
Colletotrichum shisoi	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Glomerellales → Glomerellaceae → Colletotrichum → Colletotrichum destructivum species complex → Colletotrichum shisoi	0.30 %
Fusarium sp. NRRL 66182	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → unclassified Fusarium → Fusarium sp. NRRL 66182	0.30 %
Bimuria novae-zelandiae	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Massarineae → Didymosphaeriaceae → Bimuria → Bimuria novae-zelandiae	0.30 %
Oidiodendron maius Zn	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Myxotrichaceae → Oidiodendron → Oidiodendron maius → Oidiodendron maius Zn	0.30 %
Glonium stellatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis → Gloniaceae → Glonium → Glonium stellatum	0.30 %
Aureobasidium pullulans	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Dothideales → Saccotheciaceae → Aureobasidium → Aureobasidium pullulans	0.30 %
Pseudogymnoascus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Pseudeurotiaceae → Pseudogymnoascus	0.30 %
Moniliophthora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Zopfia rhizophila CBS 207.26	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia → Zopfia rhizophila → Zopfia rhizophila CBS 207.26	0.91 %
Lasallia pustulata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae → Umbilicariales → Umbilicariaceae → Lasallia → Lasallia pustulata	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.67 %
Bimuria novae-zelandiae CBS 107.79	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Massarineae → Didymosphaeriaceae → Bimuria → Bimuria novae-zelandiae → Bimuria novae-zelandiae CBS 107.79	0.30 %
Lepidopterella palustris CBS 459.81	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales → Argynnaceae → Lepidopterella → Lepidopterella palustris → Lepidopterella palustris CBS 459.81	0.30 %
Pleomassaria siparia CBS 279.74	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleomassariaceae → Pleomassaria → Pleomassaria siparia → Pleomassaria siparia CBS 279.74	0.30 %
Colletotrichum shisoi	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Glomerellales → Glomerellaceae → Colletotrichum → Colletotrichum destructivum species complex → Colletotrichum shisoi	0.30 %
Fusarium sp. NRRL 66182	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → unclassified Fusarium → Fusarium sp. NRRL 66182	0.30 %
Oidiodendron maius Zn	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Myxotrichaceae → Oidiodendron → Oidiodendron maius → Oidiodendron maius Zn	0.30 %
Glonium stellatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis → Gloniaceae → Glonium → Glonium stellatum	0.30 %
Aureobasidium pullulans	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Dothideales → Saccotheciaceae → Aureobasidium → Aureobasidium pullulans	0.30 %
Pseudogymnoascus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Pseudeurotiaceae → Pseudogymnoascus	0.30 %
Moniliophthora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora	0.30 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.30 %
Zopfia rhizophila CBS 207.26	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia → Zopfia rhizophila → Zopfia rhizophila CBS 207.26	0.91 %
Lasallia pustulata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae → Umbilicariales → Umbilicariaceae → Lasallia → Lasallia pustulata	0.61 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002245\|JGIcombinedJ26739_100723888	Not Available	874	Open in IMG/M
3300002245\|JGIcombinedJ26739_100752483	Not Available	854	Open in IMG/M
3300002245\|JGIcombinedJ26739_101665917	Not Available	536	Open in IMG/M
3300002245\|JGIcombinedJ26739_101744845	Not Available	522	Open in IMG/M
3300010159\|Ga0099796_10422760	Not Available	588	Open in IMG/M
3300012199\|Ga0137383_10625190	Not Available	787	Open in IMG/M
3300012199\|Ga0137383_10821153	Not Available	679	Open in IMG/M
3300012208\|Ga0137376_11068357	Not Available	691	Open in IMG/M
3300012349\|Ga0137387_10988996	Not Available	604	Open in IMG/M
3300012359\|Ga0137385_10582197	Not Available	942	Open in IMG/M
3300012361\|Ga0137360_11759677	Not Available	525	Open in IMG/M
3300012672\|Ga0137317_1003745	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	1122	Open in IMG/M
3300012683\|Ga0137398_10451001	Not Available	880	Open in IMG/M
3300012927\|Ga0137416_12123496	Not Available	516	Open in IMG/M
3300015242\|Ga0137412_10842041	Not Available	670	Open in IMG/M
3300020061\|Ga0193716_1238858	Not Available	662	Open in IMG/M
3300027908\|Ga0209006_10127115	Not Available	2248	Open in IMG/M
3300027908\|Ga0209006_10132574	All Organisms → Viruses → Predicted Viral	2195	Open in IMG/M
3300027908\|Ga0209006_10319014	Not Available	1322	Open in IMG/M
3300027908\|Ga0209006_10902824	Not Available	709	Open in IMG/M
3300027908\|Ga0209006_11004532	Not Available	663	Open in IMG/M
3300027908\|Ga0209006_11193079	Not Available	595	Open in IMG/M
3300027908\|Ga0209006_11460178	Not Available	520	Open in IMG/M
3300028047\|Ga0209526_10016492	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes	5123	Open in IMG/M
3300028794\|Ga0307515_10001510	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales	52070	Open in IMG/M
3300028794\|Ga0307515_10001510	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales	52070	Open in IMG/M
3300028794\|Ga0307515_10001688	All Organisms → cellular organisms → Eukaryota → Opisthokonta	49230	Open in IMG/M
3300028794\|Ga0307515_10001905	All Organisms → cellular organisms → Eukaryota → Opisthokonta	46382	Open in IMG/M
3300028794\|Ga0307515_10002736	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	37718	Open in IMG/M
3300028794\|Ga0307515_10003604	All Organisms → cellular organisms → Eukaryota → Opisthokonta	32518	Open in IMG/M
3300028794\|Ga0307515_10003605	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes	32513	Open in IMG/M
3300028794\|Ga0307515_10003641	All Organisms → cellular organisms → Eukaryota → Opisthokonta	32381	Open in IMG/M
3300028794\|Ga0307515_10003678	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae	32215	Open in IMG/M
3300028794\|Ga0307515_10005140	All Organisms → cellular organisms → Eukaryota → Opisthokonta	26607	Open in IMG/M
3300028794\|Ga0307515_10005489	Not Available	25661	Open in IMG/M
3300028794\|Ga0307515_10005589	All Organisms → cellular organisms → Eukaryota	25404	Open in IMG/M
3300028794\|Ga0307515_10005733	Not Available	25088	Open in IMG/M
3300028794\|Ga0307515_10005780	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae	24979	Open in IMG/M
3300028794\|Ga0307515_10005905	Not Available	24696	Open in IMG/M
3300028794\|Ga0307515_10005980	All Organisms → cellular organisms → Eukaryota → Opisthokonta	24505	Open in IMG/M
3300028794\|Ga0307515_10006004	Not Available	24448	Open in IMG/M
3300028794\|Ga0307515_10006074	Not Available	24285	Open in IMG/M
3300028794\|Ga0307515_10006257	Not Available	23884	Open in IMG/M
3300028794\|Ga0307515_10006434	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes	23496	Open in IMG/M
3300028794\|Ga0307515_10006468	Not Available	23447	Open in IMG/M
3300028794\|Ga0307515_10006716	Not Available	22909	Open in IMG/M
3300028794\|Ga0307515_10006866	All Organisms → cellular organisms → Eukaryota	22645	Open in IMG/M
3300028794\|Ga0307515_10006962	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes	22453	Open in IMG/M
3300028794\|Ga0307515_10006963	All Organisms → cellular organisms → Eukaryota → Opisthokonta	22450	Open in IMG/M
3300028794\|Ga0307515_10007064	Not Available	22307	Open in IMG/M
3300028794\|Ga0307515_10007115	Not Available	22225	Open in IMG/M
3300028794\|Ga0307515_10007362	Not Available	21775	Open in IMG/M
3300028794\|Ga0307515_10007400	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales	21705	Open in IMG/M
3300028794\|Ga0307515_10007814	Not Available	21039	Open in IMG/M
3300028794\|Ga0307515_10008087	All Organisms → cellular organisms → Eukaryota → Opisthokonta	20610	Open in IMG/M
3300028794\|Ga0307515_10008170	Not Available	20489	Open in IMG/M
3300028794\|Ga0307515_10008597	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes	19880	Open in IMG/M
3300028794\|Ga0307515_10008743	All Organisms → cellular organisms → Eukaryota → Opisthokonta	19675	Open in IMG/M
3300028794\|Ga0307515_10008771	Not Available	19647	Open in IMG/M
3300028794\|Ga0307515_10008841	Not Available	19558	Open in IMG/M
3300028794\|Ga0307515_10008889	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	19515	Open in IMG/M
3300028794\|Ga0307515_10008922	All Organisms → cellular organisms → Eukaryota → Opisthokonta	19481	Open in IMG/M
3300028794\|Ga0307515_10009131	All Organisms → cellular organisms → Eukaryota → Opisthokonta	19228	Open in IMG/M
3300028794\|Ga0307515_10009205	All Organisms → cellular organisms → Eukaryota → Opisthokonta	19129	Open in IMG/M
3300028794\|Ga0307515_10009366	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	18948	Open in IMG/M
3300028794\|Ga0307515_10009440	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales	18858	Open in IMG/M
3300028794\|Ga0307515_10009510	Not Available	18786	Open in IMG/M
3300028794\|Ga0307515_10009525	All Organisms → cellular organisms → Eukaryota → Opisthokonta	18764	Open in IMG/M
3300028794\|Ga0307515_10009538	Not Available	18749	Open in IMG/M
3300028794\|Ga0307515_10009538	Not Available	18749	Open in IMG/M
3300028794\|Ga0307515_10010239	Not Available	18002	Open in IMG/M
3300028794\|Ga0307515_10010466	All Organisms → cellular organisms → Eukaryota → Opisthokonta	17775	Open in IMG/M
3300028794\|Ga0307515_10011303	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes	16951	Open in IMG/M
3300028794\|Ga0307515_10011618	Not Available	16691	Open in IMG/M
3300028794\|Ga0307515_10011635	Not Available	16678	Open in IMG/M
3300028794\|Ga0307515_10011701	Not Available	16606	Open in IMG/M
3300028794\|Ga0307515_10011768	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Myxotrichaceae → Oidiodendron → Oidiodendron maius → Oidiodendron maius Zn	16557	Open in IMG/M
3300028794\|Ga0307515_10012027	Not Available	16340	Open in IMG/M
3300028794\|Ga0307515_10012240	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Dothideales → Saccotheciaceae → Aureobasidium → Aureobasidium pullulans	16158	Open in IMG/M
3300028794\|Ga0307515_10012277	All Organisms → cellular organisms → Eukaryota → Opisthokonta	16130	Open in IMG/M
3300028794\|Ga0307515_10012344	All Organisms → cellular organisms → Eukaryota	16076	Open in IMG/M
3300028794\|Ga0307515_10012360	Not Available	16066	Open in IMG/M
3300028794\|Ga0307515_10012593	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	15898	Open in IMG/M
3300028794\|Ga0307515_10012676	All Organisms → cellular organisms → Eukaryota → Opisthokonta	15834	Open in IMG/M
3300028794\|Ga0307515_10012889	All Organisms → cellular organisms → Eukaryota → Opisthokonta	15681	Open in IMG/M
3300028794\|Ga0307515_10013128	Not Available	15505	Open in IMG/M
3300028794\|Ga0307515_10013155	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia → Zopfia rhizophila → Zopfia rhizophila CBS 207.26	15487	Open in IMG/M
3300028794\|Ga0307515_10013239	Not Available	15430	Open in IMG/M
3300028794\|Ga0307515_10013619	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	15165	Open in IMG/M
3300028794\|Ga0307515_10013627	All Organisms → cellular organisms → Eukaryota → Opisthokonta	15159	Open in IMG/M
3300028794\|Ga0307515_10013644	All Organisms → cellular organisms → Eukaryota → Opisthokonta	15142	Open in IMG/M
3300028794\|Ga0307515_10013661	Not Available	15131	Open in IMG/M
3300028794\|Ga0307515_10014125	All Organisms → cellular organisms → Eukaryota → Opisthokonta	14844	Open in IMG/M
3300028794\|Ga0307515_10014125	All Organisms → cellular organisms → Eukaryota → Opisthokonta	14844	Open in IMG/M
3300028794\|Ga0307515_10014189	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae → Umbilicariales → Umbilicariaceae → Lasallia → Lasallia pustulata	14805	Open in IMG/M
3300028794\|Ga0307515_10014659	Not Available	14513	Open in IMG/M
3300028794\|Ga0307515_10014989	Not Available	14319	Open in IMG/M
3300028794\|Ga0307515_10015060	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleomassariaceae → Pleomassaria → Pleomassaria siparia → Pleomassaria siparia CBS 279.74	14285	Open in IMG/M
3300028794\|Ga0307515_10015216	Not Available	14194	Open in IMG/M
3300028794\|Ga0307515_10015694	Not Available	13938	Open in IMG/M
3300028794\|Ga0307515_10016345	All Organisms → cellular organisms → Eukaryota → Opisthokonta	13594	Open in IMG/M
3300028794\|Ga0307515_10016528	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Glomerellales → Glomerellaceae → Colletotrichum → Colletotrichum destructivum species complex → Colletotrichum shisoi	13500	Open in IMG/M
3300028794\|Ga0307515_10016556	Not Available	13493	Open in IMG/M
3300028794\|Ga0307515_10016649	Not Available	13445	Open in IMG/M
3300028794\|Ga0307515_10017129	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis → Gloniaceae → Glonium → Glonium stellatum	13222	Open in IMG/M
3300028794\|Ga0307515_10017275	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13153	Open in IMG/M
3300028794\|Ga0307515_10017602	Not Available	13000	Open in IMG/M
3300028794\|Ga0307515_10018207	All Organisms → cellular organisms → Eukaryota	12740	Open in IMG/M
3300028794\|Ga0307515_10018744	All Organisms → cellular organisms → Eukaryota → Opisthokonta	12495	Open in IMG/M
3300028794\|Ga0307515_10018848	Not Available	12459	Open in IMG/M
3300028794\|Ga0307515_10018932	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales	12430	Open in IMG/M
3300028794\|Ga0307515_10019335	Not Available	12272	Open in IMG/M
3300028794\|Ga0307515_10019606	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae	12152	Open in IMG/M
3300028794\|Ga0307515_10019656	Not Available	12129	Open in IMG/M
3300028794\|Ga0307515_10019818	Not Available	12065	Open in IMG/M
3300028794\|Ga0307515_10019879	Not Available	12037	Open in IMG/M
3300028794\|Ga0307515_10019976	All Organisms → cellular organisms → Eukaryota	11998	Open in IMG/M
3300028794\|Ga0307515_10020060	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	11965	Open in IMG/M
3300028794\|Ga0307515_10020096	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia → Zopfia rhizophila → Zopfia rhizophila CBS 207.26	11954	Open in IMG/M
3300028794\|Ga0307515_10020104	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	11951	Open in IMG/M
3300028794\|Ga0307515_10021029	Not Available	11592	Open in IMG/M
3300028794\|Ga0307515_10021418	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia → Zopfia rhizophila → Zopfia rhizophila CBS 207.26	11465	Open in IMG/M
3300028794\|Ga0307515_10022179	Not Available	11207	Open in IMG/M
3300028794\|Ga0307515_10022364	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	11145	Open in IMG/M
3300028794\|Ga0307515_10022708	Not Available	11042	Open in IMG/M
3300028794\|Ga0307515_10023179	Not Available	10895	Open in IMG/M
3300028794\|Ga0307515_10023216	All Organisms → cellular organisms → Eukaryota → Opisthokonta	10884	Open in IMG/M
3300028794\|Ga0307515_10023246	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae → Umbilicariales → Umbilicariaceae → Lasallia → Lasallia pustulata	10873	Open in IMG/M
3300028794\|Ga0307515_10023873	All Organisms → cellular organisms → Eukaryota → Opisthokonta	10690	Open in IMG/M
3300028794\|Ga0307515_10024194	Not Available	10593	Open in IMG/M
3300028794\|Ga0307515_10024357	Not Available	10550	Open in IMG/M
3300028794\|Ga0307515_10024491	Not Available	10514	Open in IMG/M
3300028794\|Ga0307515_10024848	All Organisms → cellular organisms → Eukaryota → Opisthokonta	10403	Open in IMG/M
3300028794\|Ga0307515_10024936	All Organisms → cellular organisms → Eukaryota → Opisthokonta	10379	Open in IMG/M
3300028794\|Ga0307515_10025340	Not Available	10269	Open in IMG/M
3300028794\|Ga0307515_10025408	Not Available	10251	Open in IMG/M
3300028794\|Ga0307515_10025491	Not Available	10227	Open in IMG/M
3300028794\|Ga0307515_10026274	Not Available	10029	Open in IMG/M
3300028794\|Ga0307515_10026429	Not Available	9990	Open in IMG/M
3300028794\|Ga0307515_10026680	Not Available	9927	Open in IMG/M
3300028794\|Ga0307515_10027111	Not Available	9813	Open in IMG/M
3300028794\|Ga0307515_10027531	Not Available	9712	Open in IMG/M
3300028794\|Ga0307515_10027656	Not Available	9682	Open in IMG/M
3300028794\|Ga0307515_10027948	Not Available	9609	Open in IMG/M
3300028794\|Ga0307515_10028117	All Organisms → cellular organisms → Eukaryota → Opisthokonta	9570	Open in IMG/M
3300028794\|Ga0307515_10028185	Not Available	9556	Open in IMG/M
3300028794\|Ga0307515_10028886	Not Available	9403	Open in IMG/M
3300028794\|Ga0307515_10028993	Not Available	9379	Open in IMG/M
3300028794\|Ga0307515_10029611	Not Available	9242	Open in IMG/M
3300028794\|Ga0307515_10030850	Not Available	8975	Open in IMG/M
3300028794\|Ga0307515_10031003	Not Available	8943	Open in IMG/M
3300028794\|Ga0307515_10031061	Not Available	8928	Open in IMG/M
3300028794\|Ga0307515_10031140	Not Available	8908	Open in IMG/M
3300028794\|Ga0307515_10031505	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → unclassified Fusarium → Fusarium sp. NRRL 66182	8837	Open in IMG/M
3300028794\|Ga0307515_10031594	Not Available	8818	Open in IMG/M
3300028794\|Ga0307515_10032003	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Pseudeurotiaceae → Pseudogymnoascus	8735	Open in IMG/M
3300028794\|Ga0307515_10032482	Not Available	8646	Open in IMG/M
3300028794\|Ga0307515_10032966	Not Available	8551	Open in IMG/M
3300028794\|Ga0307515_10033298	Not Available	8490	Open in IMG/M
3300028794\|Ga0307515_10033567	Not Available	8439	Open in IMG/M
3300028794\|Ga0307515_10033746	Not Available	8411	Open in IMG/M
3300028794\|Ga0307515_10035621	Not Available	8086	Open in IMG/M
3300028794\|Ga0307515_10035703	Not Available	8073	Open in IMG/M
3300028794\|Ga0307515_10037311	Not Available	7820	Open in IMG/M
3300028794\|Ga0307515_10038034	Not Available	7714	Open in IMG/M
3300028794\|Ga0307515_10038567	Not Available	7637	Open in IMG/M
3300028794\|Ga0307515_10040601	Not Available	7352	Open in IMG/M
3300028794\|Ga0307515_10040744	Not Available	7333	Open in IMG/M
3300028794\|Ga0307515_10042254	All Organisms → cellular organisms → Eukaryota → Opisthokonta	7139	Open in IMG/M
3300028794\|Ga0307515_10042992	Not Available	7042	Open in IMG/M
3300028794\|Ga0307515_10043363	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Glomerellales → Glomerellaceae → Colletotrichum	6995	Open in IMG/M
3300028794\|Ga0307515_10044468	Not Available	6859	Open in IMG/M
3300028794\|Ga0307515_10044523	Not Available	6853	Open in IMG/M
3300028794\|Ga0307515_10044658	Not Available	6837	Open in IMG/M
3300028794\|Ga0307515_10045950	Not Available	6690	Open in IMG/M
3300028794\|Ga0307515_10046346	Not Available	6647	Open in IMG/M
3300028794\|Ga0307515_10046418	Not Available	6640	Open in IMG/M
3300028794\|Ga0307515_10046564	Not Available	6624	Open in IMG/M
3300028794\|Ga0307515_10047143	Not Available	6562	Open in IMG/M
3300028794\|Ga0307515_10047364	Not Available	6536	Open in IMG/M
3300028794\|Ga0307515_10047366	Not Available	6536	Open in IMG/M
3300028794\|Ga0307515_10047596	Not Available	6513	Open in IMG/M
3300028794\|Ga0307515_10048414	Not Available	6427	Open in IMG/M
3300028794\|Ga0307515_10048909	Not Available	6382	Open in IMG/M
3300028794\|Ga0307515_10049017	Not Available	6371	Open in IMG/M
3300028794\|Ga0307515_10049047	Not Available	6368	Open in IMG/M
3300028794\|Ga0307515_10049162	Not Available	6355	Open in IMG/M
3300028794\|Ga0307515_10049826	Not Available	6286	Open in IMG/M
3300028794\|Ga0307515_10050361	Not Available	6240	Open in IMG/M
3300028794\|Ga0307515_10050832	Not Available	6197	Open in IMG/M
3300028794\|Ga0307515_10051734	Not Available	6114	Open in IMG/M
3300028794\|Ga0307515_10051773	Not Available	6111	Open in IMG/M
3300028794\|Ga0307515_10051857	Not Available	6102	Open in IMG/M
3300028794\|Ga0307515_10051903	Not Available	6099	Open in IMG/M
3300028794\|Ga0307515_10052636	Not Available	6032	Open in IMG/M
3300028794\|Ga0307515_10053691	Not Available	5937	Open in IMG/M
3300028794\|Ga0307515_10054961	Not Available	5831	Open in IMG/M
3300028794\|Ga0307515_10055760	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	5764	Open in IMG/M
3300028794\|Ga0307515_10056200	Not Available	5727	Open in IMG/M
3300028794\|Ga0307515_10056738	Not Available	5684	Open in IMG/M
3300028794\|Ga0307515_10056890	Not Available	5672	Open in IMG/M
3300028794\|Ga0307515_10058368	Not Available	5559	Open in IMG/M
3300028794\|Ga0307515_10059155	Not Available	5499	Open in IMG/M
3300028794\|Ga0307515_10059490	Not Available	5473	Open in IMG/M
3300028794\|Ga0307515_10060001	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Massarineae → Didymosphaeriaceae → Bimuria → Bimuria novae-zelandiae → Bimuria novae-zelandiae CBS 107.79	5438	Open in IMG/M
3300028794\|Ga0307515_10061347	Not Available	5337	Open in IMG/M
3300028794\|Ga0307515_10063181	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	5209	Open in IMG/M
3300028794\|Ga0307515_10063435	Not Available	5190	Open in IMG/M
3300028794\|Ga0307515_10063603	Not Available	5178	Open in IMG/M
3300028794\|Ga0307515_10064051	Not Available	5147	Open in IMG/M
3300028794\|Ga0307515_10064248	Not Available	5134	Open in IMG/M
3300028794\|Ga0307515_10064761	Not Available	5105	Open in IMG/M
3300028794\|Ga0307515_10065699	Not Available	5042	Open in IMG/M
3300028794\|Ga0307515_10066211	Not Available	5010	Open in IMG/M
3300028794\|Ga0307515_10066580	All Organisms → Viruses → Predicted Viral	4987	Open in IMG/M
3300028794\|Ga0307515_10069626	All Organisms → Viruses → Predicted Viral	4804	Open in IMG/M
3300028794\|Ga0307515_10070016	All Organisms → Viruses → Predicted Viral	4782	Open in IMG/M
3300028794\|Ga0307515_10070122	All Organisms → cellular organisms → Eukaryota	4776	Open in IMG/M
3300028794\|Ga0307515_10070171	All Organisms → Viruses → Predicted Viral	4774	Open in IMG/M
3300028794\|Ga0307515_10071103	All Organisms → Viruses → Predicted Viral	4721	Open in IMG/M
3300028794\|Ga0307515_10071211	All Organisms → Viruses → Predicted Viral	4715	Open in IMG/M
3300028794\|Ga0307515_10071626	All Organisms → Viruses → Predicted Viral	4694	Open in IMG/M
3300028794\|Ga0307515_10071628	All Organisms → Viruses → Predicted Viral	4694	Open in IMG/M
3300028794\|Ga0307515_10072372	All Organisms → Viruses → Predicted Viral	4653	Open in IMG/M
3300028794\|Ga0307515_10072658	All Organisms → Viruses → Predicted Viral	4636	Open in IMG/M
3300028794\|Ga0307515_10073828	All Organisms → Viruses → Predicted Viral	4575	Open in IMG/M
3300028794\|Ga0307515_10075008	All Organisms → Viruses → Predicted Viral	4514	Open in IMG/M
3300028794\|Ga0307515_10076322	All Organisms → Viruses → Predicted Viral	4448	Open in IMG/M
3300028794\|Ga0307515_10076469	All Organisms → Viruses → Predicted Viral	4440	Open in IMG/M
3300028794\|Ga0307515_10077408	All Organisms → Viruses → Predicted Viral	4393	Open in IMG/M
3300028794\|Ga0307515_10078351	All Organisms → Viruses → Predicted Viral	4347	Open in IMG/M
3300028794\|Ga0307515_10079391	All Organisms → Viruses → Predicted Viral	4299	Open in IMG/M
3300028794\|Ga0307515_10079986	All Organisms → Viruses → Predicted Viral	4271	Open in IMG/M
3300028794\|Ga0307515_10083512	All Organisms → Viruses → Predicted Viral	4116	Open in IMG/M
3300028794\|Ga0307515_10083851	All Organisms → Viruses → Predicted Viral	4103	Open in IMG/M
3300028794\|Ga0307515_10084610	All Organisms → Viruses → Predicted Viral	4071	Open in IMG/M
3300028794\|Ga0307515_10085079	Not Available	4052	Open in IMG/M
3300028794\|Ga0307515_10085569	All Organisms → Viruses → Predicted Viral	4032	Open in IMG/M
3300028794\|Ga0307515_10085694	All Organisms → Viruses → Predicted Viral	4027	Open in IMG/M
3300028794\|Ga0307515_10086178	All Organisms → Viruses → Predicted Viral	4008	Open in IMG/M
3300028794\|Ga0307515_10088034	All Organisms → Viruses → Predicted Viral	3931	Open in IMG/M
3300028794\|Ga0307515_10088927	All Organisms → Viruses → Predicted Viral	3896	Open in IMG/M
3300028794\|Ga0307515_10089003	All Organisms → Viruses → Predicted Viral	3893	Open in IMG/M
3300028794\|Ga0307515_10089825	All Organisms → Viruses → Predicted Viral	3861	Open in IMG/M
3300028794\|Ga0307515_10090224	All Organisms → Viruses → Predicted Viral	3847	Open in IMG/M
3300028794\|Ga0307515_10091748	All Organisms → Viruses → Predicted Viral	3790	Open in IMG/M
3300028794\|Ga0307515_10092509	All Organisms → Viruses → Predicted Viral	3763	Open in IMG/M
3300028794\|Ga0307515_10094473	All Organisms → Viruses → Predicted Viral	3693	Open in IMG/M
3300028794\|Ga0307515_10097506	All Organisms → Viruses → Predicted Viral	3592	Open in IMG/M
3300028794\|Ga0307515_10098278	Not Available	3567	Open in IMG/M
3300028794\|Ga0307515_10098922	All Organisms → Viruses → Predicted Viral	3547	Open in IMG/M
3300028794\|Ga0307515_10100644	All Organisms → Viruses → Predicted Viral	3497	Open in IMG/M
3300028794\|Ga0307515_10100678	Not Available	3496	Open in IMG/M
3300028794\|Ga0307515_10100692	All Organisms → Viruses → Predicted Viral	3495	Open in IMG/M
3300028794\|Ga0307515_10101253	All Organisms → Viruses → Predicted Viral	3479	Open in IMG/M
3300028794\|Ga0307515_10105442	All Organisms → Viruses → Predicted Viral	3355	Open in IMG/M
3300028794\|Ga0307515_10107403	All Organisms → Viruses → Predicted Viral	3299	Open in IMG/M
3300028794\|Ga0307515_10111458	All Organisms → Viruses → Predicted Viral	3192	Open in IMG/M
3300028794\|Ga0307515_10113658	All Organisms → Viruses → Predicted Viral	3137	Open in IMG/M
3300028794\|Ga0307515_10114147	Not Available	3125	Open in IMG/M
3300028794\|Ga0307515_10117538	All Organisms → Viruses → Predicted Viral	3043	Open in IMG/M
3300028794\|Ga0307515_10121971	All Organisms → Viruses → Predicted Viral	2944	Open in IMG/M
3300028794\|Ga0307515_10125211	All Organisms → Viruses → Predicted Viral	2877	Open in IMG/M
3300028794\|Ga0307515_10125820	All Organisms → Viruses → Predicted Viral	2864	Open in IMG/M
3300028794\|Ga0307515_10130186	All Organisms → Viruses → Predicted Viral	2778	Open in IMG/M
3300028794\|Ga0307515_10130240	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2777	Open in IMG/M
3300028794\|Ga0307515_10132102	Not Available	2741	Open in IMG/M
3300028794\|Ga0307515_10136285	Not Available	2667	Open in IMG/M
3300028794\|Ga0307515_10136594	All Organisms → Viruses → Predicted Viral	2661	Open in IMG/M
3300028794\|Ga0307515_10138138	All Organisms → Viruses → Predicted Viral	2633	Open in IMG/M
3300028794\|Ga0307515_10142830	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora	2556	Open in IMG/M
3300028794\|Ga0307515_10144226	All Organisms → Viruses → Predicted Viral	2533	Open in IMG/M
3300028794\|Ga0307515_10146822	All Organisms → Viruses → Predicted Viral	2492	Open in IMG/M
3300028794\|Ga0307515_10148607	All Organisms → Viruses → Predicted Viral	2464	Open in IMG/M
3300028794\|Ga0307515_10160519	Not Available	2295	Open in IMG/M
3300028794\|Ga0307515_10180878	Not Available	2059	Open in IMG/M
3300028794\|Ga0307515_10182287	All Organisms → Viruses → Predicted Viral	2044	Open in IMG/M
3300028794\|Ga0307515_10207926	Not Available	1811	Open in IMG/M
3300028794\|Ga0307515_10209190	All Organisms → Viruses → Predicted Viral	1800	Open in IMG/M
3300028794\|Ga0307515_10210462	Not Available	1790	Open in IMG/M
3300028794\|Ga0307515_10227590	Not Available	1666	Open in IMG/M
3300028794\|Ga0307515_10235926	Not Available	1610	Open in IMG/M
3300028794\|Ga0307515_10243276	Not Available	1565	Open in IMG/M
3300028794\|Ga0307515_10249654	All Organisms → Viruses → Predicted Viral	1529	Open in IMG/M
3300028794\|Ga0307515_10255349	Not Available	1498	Open in IMG/M
3300028794\|Ga0307515_10257627	Not Available	1486	Open in IMG/M
3300028794\|Ga0307515_10302384	Not Available	1283	Open in IMG/M
3300028794\|Ga0307515_10376671	Not Available	1053	Open in IMG/M
3300028794\|Ga0307515_10384601	Not Available	1034	Open in IMG/M
3300028794\|Ga0307515_10390616	Not Available	1021	Open in IMG/M
3300028794\|Ga0307515_10443026	Not Available	915	Open in IMG/M
3300028794\|Ga0307515_10757147	Not Available	591	Open in IMG/M
3300028794\|Ga0307515_10789367	Not Available	571	Open in IMG/M
3300030522\|Ga0307512_10241868	Not Available	912	Open in IMG/M
3300030522\|Ga0307512_10423208	Not Available	549	Open in IMG/M
3300031446\|Ga0170820_14263157	Not Available	506	Open in IMG/M
3300031838\|Ga0307518_10280633	Not Available	1031	Open in IMG/M
3300031838\|Ga0307518_10298603	Not Available	981	Open in IMG/M
3300031838\|Ga0307518_10583210	Not Available	541	Open in IMG/M
3300033179\|Ga0307507_10000058	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	164498	Open in IMG/M
3300033179\|Ga0307507_10000065	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	160945	Open in IMG/M
3300033179\|Ga0307507_10000166	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	118591	Open in IMG/M
3300033179\|Ga0307507_10000245	All Organisms → cellular organisms → Eukaryota → Opisthokonta	105737	Open in IMG/M
3300033179\|Ga0307507_10000347	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae	94353	Open in IMG/M
3300033179\|Ga0307507_10000384	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae	91368	Open in IMG/M
3300033179\|Ga0307507_10000421	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	88427	Open in IMG/M
3300033179\|Ga0307507_10000554	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae	80083	Open in IMG/M
3300033179\|Ga0307507_10000964	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	63979	Open in IMG/M
3300033179\|Ga0307507_10000970	Not Available	63792	Open in IMG/M
3300033179\|Ga0307507_10001006	All Organisms → cellular organisms → Eukaryota → Opisthokonta	62822	Open in IMG/M
3300033179\|Ga0307507_10001885	All Organisms → cellular organisms → Eukaryota → Opisthokonta	45727	Open in IMG/M
3300033179\|Ga0307507_10002006	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales → Argynnaceae → Lepidopterella → Lepidopterella palustris → Lepidopterella palustris CBS 459.81	44154	Open in IMG/M
3300033179\|Ga0307507_10003337	Not Available	31404	Open in IMG/M
3300033179\|Ga0307507_10003687	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	28938	Open in IMG/M
3300033179\|Ga0307507_10004786	All Organisms → cellular organisms → Eukaryota → Opisthokonta	23362	Open in IMG/M
3300033179\|Ga0307507_10015463	All Organisms → cellular organisms → Eukaryota → Opisthokonta	8973	Open in IMG/M
3300033179\|Ga0307507_10018075	Not Available	8047	Open in IMG/M
3300033179\|Ga0307507_10028443	Not Available	5958	Open in IMG/M
3300033179\|Ga0307507_10239195	Not Available	1191	Open in IMG/M
3300033179\|Ga0307507_10293102	Not Available	1005	Open in IMG/M
3300033179\|Ga0307507_10378347	Not Available	817	Open in IMG/M
3300033179\|Ga0307507_10424763	Not Available	745	Open in IMG/M
3300033179\|Ga0307507_10433454	Not Available	733	Open in IMG/M
3300033179\|Ga0307507_10439647	Not Available	725	Open in IMG/M
3300033179\|Ga0307507_10498638	Not Available	657	Open in IMG/M
3300033179\|Ga0307507_10513485	Not Available	642	Open in IMG/M
3300033179\|Ga0307507_10678348	Not Available	518	Open in IMG/M
3300033179\|Ga0307507_10683591	Not Available	515	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	92.42%
Environmental	Environmental	7.58%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	92.42%
Terrestrial	Environmental → Terrestrial	7.27%
Aquatic	Environmental → Aquatic	0.30%

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	92.42%
Soil	Environmental → Terrestrial → Soil	7.27%
Sediment	Environmental → Aquatic → Sediment	0.30%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	92.42%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.64%
Loam	Environmental → Terrestrial → Soil → Loam	3.64%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.30%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	92.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.64%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.30%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.30%

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	92.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	3.64%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.03%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.30%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.30%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.30%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012672	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300020061	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1	Environmental	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGIcombinedJ26739_1007238881	3300002245	Forest Soil	MELLYRRKEHFYLLIIILEDLIAYKGGIINFKVGLI*
JGIcombinedJ26739_1007524831	3300002245	Forest Soil	VVKKIELLYGWGEYLYPLVIILEDLIAYKEGIINLKIKPI*
JGIcombinedJ26739_1016659171	3300002245	Forest Soil	MGLLYRQKERLYLLVIILEDLIAYRGGIINLKIEPI*
JGIcombinedJ26739_1017448451	3300002245	Forest Soil	MELQYRQKKYLYLLIIILGDLITYRGGIINLKIGPI*
Ga0099796_104227601	3300010159	Vadose Zone Soil	VVKRMGLPYKQKERPYPLVTILGDLIAYRGGIINLKTGLI*
Ga0137383_106251901	3300012199	Vadose Zone Soil	MGLPYRQKESLYLLVIILGDLIAYRGGIINLKTGPI*
Ga0137383_108211532	3300012199	Vadose Zone Soil	ILLVAVKRIGLPYRDKENPYLLVTIFGDLIIYRDGII*
Ga0137376_110683571	3300012208	Vadose Zone Soil	MLLVAVKRIGLLYRDKENPYLLVTILGDLIIYRDGII*
Ga0137387_109889961	3300012349	Vadose Zone Soil	LLSAVKRIGLLYRDKENPYLLVIILRDLIIYRDGII*
Ga0137385_105821971	3300012359	Vadose Zone Soil	MLPITVKKIGLLYRDKETLYLLITILGDLILYRDNII*
Ga0137360_117596771	3300012361	Vadose Zone Soil	IVKQIGLPYRRKELLYLLVIILGDLIAYRGGIINLKIGPI*
Ga0137317_10037451	3300012672	Soil	IAVKRIGLLHRQKKHLYLLTTISGDLIAYRGGIINLKTGPI*
Ga0137398_104510011	3300012683	Vadose Zone Soil	IGLPHQQKKHLYLLVTILGDLIAYKGDLINLKTGPI*
Ga0137416_121234961	3300012927	Vadose Zone Soil	LAAVKRIGLLHRRKESLYLLVTILGDLIAYRGGIINLKIGPI*
Ga0137412_108420411	3300015242	Vadose Zone Soil	MGNYLLLIVVKRIELPYRKQKSLYLLITILGDLIAYRDGIIN
Ga0193716_12388581	3300020061	Soil	LVAVKRMGLLYRKKECSYLLVTILGDLIAYGGGIINLKIGPI
Ga0209006_101271151	3300027908	Forest Soil	MGLPYRQKKDLYPLIIILEDPIAYRGGIINLKIGLI
Ga0209006_101325741	3300027908	Forest Soil	LLIAVKRMGLLYKQKEHLYPLIIILEDLIAYKGGIINLKIRPI
Ga0209006_103190141	3300027908	Forest Soil	MGLPHRQKKHLYPLIIILGNLIAYRGGIINLKIGLIQLTIKGR
Ga0209006_109028241	3300027908	Forest Soil	GLLYRQKEYLYLLIIILKDLIAYKGGIINLKIGLI
Ga0209006_110045321	3300027908	Forest Soil	LLVVVKQMGLPHKQKEHLYLLIIILKDLIAYRGGIINLKTGLIQLTIKGR
Ga0209006_111930791	3300027908	Forest Soil	MGLLYXQKEYLYPLIIILGDLIAYRGGIINLKIELI
Ga0209006_114601781	3300027908	Forest Soil	KWMGLLHRQKERLYLLITILKDLIAYRGGIINLKTGLI
Ga0209526_100164927	3300028047	Forest Soil	MGLLYKQKEHLYLLIIILENLIAYRGGIINLKIGPI
Ga0307515_100015102	3300028794	Ectomycorrhiza	LLVAVKRIGLLYRKKEYSYLLVTILEDPIAYRGGIINLKIGPI
Ga0307515_100015103	3300028794	Ectomycorrhiza	MGLLYRKKEYFYLLVIILGDLIAYKGGIINLKTGPI
Ga0307515_100016887	3300028794	Ectomycorrhiza	MGLPYRRKEYLYLLVIILEDPIAYRDGIINLKIGPI
Ga0307515_100019053	3300028794	Ectomycorrhiza	MGLPHRKKEHPYPLVTILGDLIAYGGGIINLKIGPI
Ga0307515_100027366	3300028794	Ectomycorrhiza	LLVAVKRIGLLHRRKEYPYLLVIILGDPIAYRGGIINFKTGPI
Ga0307515_100036047	3300028794	Ectomycorrhiza	MGLSYRQKEHPYLLVIILGDPITYRGGIINLKIGFI
Ga0307515_100036058	3300028794	Ectomycorrhiza	MGLPYRKKEHPYLLVTILEDLIAYKGSIINLKIGPI
Ga0307515_1000364110	3300028794	Ectomycorrhiza	MGLPHKQKKYPYLLVIILGDPIAYGGGIINLKTGPI
Ga0307515_100036781	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVTILGDPIAYREGIINLKIGPI
Ga0307515_100051407	3300028794	Ectomycorrhiza	MGLLYRKKEYLYLLVIILGDLIAYRGGIINLKIEPI
Ga0307515_100054891	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100055892	3300028794	Ectomycorrhiza	MGLPHRKKEYPYLLVIILGNLIAYREGIINLKIGPI
Ga0307515_100057332	3300028794	Ectomycorrhiza	LLVVVKRIGLLYRKKEYPYLLVIILGDLIAYRGDLIAYRGGIINLKIGPI
Ga0307515_100057802	3300028794	Ectomycorrhiza	MGLLYRRKEHPYSLVTILEDLIVYRDSIINLEIGPI
Ga0307515_100059051	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVTILGDLIAYRGGIINLKIGLI
Ga0307515_100059801	3300028794	Ectomycorrhiza	MGLPYRQKEEPYLLVIILGDLIAYRGGIINLKTGPI
Ga0307515_100060045	3300028794	Ectomycorrhiza	MGLPYRQKEQPYLLVIILGDLIAYRGGIINLKIGLI
Ga0307515_100060743	3300028794	Ectomycorrhiza	LLIVVKRIGLPHRKKEHPYLLVTILGDLIAYRGGIINLKTGPI
Ga0307515_100062575	3300028794	Ectomycorrhiza	LLVVVKRIGLLYRKKEYPYLLIIILGDLIAYGGGIINLKIGPI
Ga0307515_100064343	3300028794	Ectomycorrhiza	MGLLYRKKKHSYLLVIILGDLIAYGGGIINLKTGPI
Ga0307515_100064683	3300028794	Ectomycorrhiza	MGLPYRQKEQLYLLVTILGDLIAYGGGIISLKIGPI
Ga0307515_100067166	3300028794	Ectomycorrhiza	MGLLYRRKEHLYLLVTILGDLIAYGDSIINLKIGPI
Ga0307515_100068662	3300028794	Ectomycorrhiza	LLVAVKKIGLPHRKKECSYLLVIILGDPIAYGGGIINLKIGPI
Ga0307515_100069624	3300028794	Ectomycorrhiza	LLAAVKRIGLLYGKKEYPYLLVTILGDPIAYGGGIISLKIGPI
Ga0307515_1000696312	3300028794	Ectomycorrhiza	MGLLYRRKEHLYLLVTILGDPIAYKDGIINLKIGPI
Ga0307515_100070642	3300028794	Ectomycorrhiza	MGLPHRKKECPYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100071153	3300028794	Ectomycorrhiza	LLAAVKRIGLPYRKKEYLYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_1000736210	3300028794	Ectomycorrhiza	MGLLYREKEYPYLLITILGDPIAYRGGIINLKIGPI
Ga0307515_100074001	3300028794	Ectomycorrhiza	LLAVIKKIGLPHRKKECLYLLVIILGDLIAYGEGIINLKIGPI
Ga0307515_100078142	3300028794	Ectomycorrhiza	LLVVVKRIGLLYRKKECPYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100080877	3300028794	Ectomycorrhiza	MGLLHKEKEHPYLLVTILGDPIAYKGGIINLKTGPI
Ga0307515_100081701	3300028794	Ectomycorrhiza	MGLLYQRKEHLYLLVTILKDLIAYKDSIINLKIGPI
Ga0307515_100085973	3300028794	Ectomycorrhiza	MGLLYRRKEYPYLLVTILGDLIAYKGGVVNLKIGPI
Ga0307515_100087431	3300028794	Ectomycorrhiza	MGLPYRKKEHPYLLVIILGDLIAYRGGIINLKTGPI
Ga0307515_100087711	3300028794	Ectomycorrhiza	MGLLYRKKEYLYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100088414	3300028794	Ectomycorrhiza	MGLPYRKKEHPYLLVTILGDLIAYKGGIINLKTGPI
Ga0307515_100088891	3300028794	Ectomycorrhiza	MGLPYRKKEYSYLLVIILGDPIAYRGGIINFKIGPI
Ga0307515_100089222	3300028794	Ectomycorrhiza	LLAVVKRIGLPHRKKECSYLLVTILGDPIAYRGGIINLKTGPI
Ga0307515_100091314	3300028794	Ectomycorrhiza	MGLLHRQKECPYLLVIILGDPIAYRGGIINLKTGPI
Ga0307515_100092055	3300028794	Ectomycorrhiza	MGLPHRKKEYFYLLVTILGDPIAYKGGIINLKTEPI
Ga0307515_100093663	3300028794	Ectomycorrhiza	MGLPYKEKEYSYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_100094403	3300028794	Ectomycorrhiza	MGLLYRKKEHLYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100095103	3300028794	Ectomycorrhiza	LLTVVKRIGLLYRKKEHPYLLVTILGDPIAYGEGIINLKIGPI
Ga0307515_100095253	3300028794	Ectomycorrhiza	MGLLYRKKEHFYLLVTILGDLIAYKGGIINLKTGPI
Ga0307515_100095381	3300028794	Ectomycorrhiza	MGLPYRQKEQSYLLVIILGDLITYRGGIINLKIGPI
Ga0307515_100095384	3300028794	Ectomycorrhiza	MGLPYRKKEYPYLLVTILGDPIAYRGGIINLKIGPI
Ga0307515_100102392	3300028794	Ectomycorrhiza	MGLPYRQKEQPYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100104662	3300028794	Ectomycorrhiza	LLAAVKRMGLLYRKKEYPYLLVTILGDPIAYGGGIINLKTGPI
Ga0307515_100113036	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLVIILGDLIAYKKEIINLKIEPI
Ga0307515_100116181	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVTILGDLIAYKGGIINLKIGPI
Ga0307515_100116351	3300028794	Ectomycorrhiza	LLVAVKRIGLLYRKKEYSYLLVTILGDPIAYKGGIINLKTGPI
Ga0307515_100117013	3300028794	Ectomycorrhiza	LLVVVKRIGLPYRKKECLYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100117683	3300028794	Ectomycorrhiza	MGLLYRKKKHPYLLVIILGDLIAYKGGIINLKTGPI
Ga0307515_100120274	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLVTILGDLIAYRGGIINLKTGPI
Ga0307515_100122404	3300028794	Ectomycorrhiza	LLAAVKRMGLLYRKKEYPYLLVTILGDLIAYRGGIINLKTGPI
Ga0307515_100122772	3300028794	Ectomycorrhiza	MGLLYRQKEHLYLLVTILGDAIAYKGGIINLKTGPI
Ga0307515_100123441	3300028794	Ectomycorrhiza	ILLIAVKRMGLLYRKKEYPYLLIIILGDLIAYGGGIINLKIGPI
Ga0307515_100123602	3300028794	Ectomycorrhiza	LLVAVKRIGLLHRKKEYPYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100125933	3300028794	Ectomycorrhiza	MGILYRKKEYPYLLVIILGDLIAYGGGIINLKIELI
Ga0307515_100126761	3300028794	Ectomycorrhiza	MGLPHRKKEHPYLLVTILGDLIAYRGGIINLKTGLI
Ga0307515_100128894	3300028794	Ectomycorrhiza	MGLLYRKKKYPYLLVTILGDLIAYGGGIINLKIGLI
Ga0307515_100131282	3300028794	Ectomycorrhiza	LLAAVKRIGLLYRKKEHLYLLVTILGDLIAYGGGIINLKTGPI
Ga0307515_100131552	3300028794	Ectomycorrhiza	MGLPHRKKECSYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100132392	3300028794	Ectomycorrhiza	MGLLYRKKEHSYLLVTILGDPIAYGGGIINLKIGPI
Ga0307515_100136191	3300028794	Ectomycorrhiza	MGLLHKKKEHFYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100136271	3300028794	Ectomycorrhiza	MGLPYREKEHPYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100136442	3300028794	Ectomycorrhiza	MGLLYRKKEYSYLLVTILGDPIAYRGGIINLKIGPI
Ga0307515_100136615	3300028794	Ectomycorrhiza	MGLLYRQKERPYLLVIILGDPIAYGGGIINLKTGPI
Ga0307515_100141251	3300028794	Ectomycorrhiza	LLAAVKRIGLLYKKKEYSYLLVIILGDPIAYKGGIINLKIGPI
Ga0307515_100141254	3300028794	Ectomycorrhiza	MGLPHRRKEHPYLLVTILGDLIAYENGIINLKIGPI
Ga0307515_100141891	3300028794	Ectomycorrhiza	MGLLYRQKRDLYLLVIILEDLIAYKGGIINLKIGPI
Ga0307515_100146595	3300028794	Ectomycorrhiza	MGLLYRKKEYSYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100149895	3300028794	Ectomycorrhiza	LPAAVKRMGLLYRKKEYPYLLVIILGDPIAYRGGIINLKTGPI
Ga0307515_100150601	3300028794	Ectomycorrhiza	MGLLYRKKEYSYLLVIILGDPIAYRGGIINFKIGPI
Ga0307515_100152163	3300028794	Ectomycorrhiza	MGLPYRQKEYPYLLVIILEDLITYKRGIINLKIGPI
Ga0307515_100156942	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLIIILGDLIAYRGGIINLKIGPI
Ga0307515_100163451	3300028794	Ectomycorrhiza	MGLLYRRKEHLYLLVIILGDPIAYGDGIINLKTGPI
Ga0307515_100165283	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100165561	3300028794	Ectomycorrhiza	MGLLHRKKEYPYLLVIILGDPIAYRGGIINLKIEPI
Ga0307515_100166493	3300028794	Ectomycorrhiza	MGLPYRQKEKPYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_100171292	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVIILGDPIAYGGGIINLKIGPI
Ga0307515_100172752	3300028794	Ectomycorrhiza	MGLPHKKKEHPYLLVTISGDLIAYGGGIINLKIGPI
Ga0307515_100176022	3300028794	Ectomycorrhiza	MGLPHRKKEYPYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100182071	3300028794	Ectomycorrhiza	LLIVVKKIGLLYREKKHPYLLVIILGDLIAYRRGIINLKTGPI
Ga0307515_100187441	3300028794	Ectomycorrhiza	MGLPYRKKEHLYSLVTISGDLIAYGDSIINLKTGPI
Ga0307515_100188483	3300028794	Ectomycorrhiza	MGLLHRKKEYSYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_100189321	3300028794	Ectomycorrhiza	GLPHRKKECLYLLVIILGDPIAYRRGIINFKIGPI
Ga0307515_100193351	3300028794	Ectomycorrhiza	MGLPYKKREHPYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_100196061	3300028794	Ectomycorrhiza	AVKKMGLLHRKKEHPYLLVTILGDLIAYKGGIINLKTGPI
Ga0307515_100196561	3300028794	Ectomycorrhiza	MGLLYRKKECFYLLVTILGDPIAYRGGIINLKIGPI
Ga0307515_100198181	3300028794	Ectomycorrhiza	MGLPYRRKEYLYLLVIILGDLIAYGDSIINLKTGPI
Ga0307515_100198791	3300028794	Ectomycorrhiza	MGLLHRKKEYSYLLVTILGDPIAYGDGIINLKTGPI
Ga0307515_100199763	3300028794	Ectomycorrhiza	MGLPHRKKEYSYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_100200603	3300028794	Ectomycorrhiza	MGLPHRKKECPYLLVIILGDPIAYGGGIINLKIGPI
Ga0307515_100200962	3300028794	Ectomycorrhiza	LLIVVKRMGLLYRKKECPYLLVIILGDLIAYRGGIINLKTGPI
Ga0307515_100201041	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLVTILGDPIAYRGGIINLKTGPI
Ga0307515_100210291	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_100214182	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVTILGDPIAYRGGIINLKIGPI
Ga0307515_100221792	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVIILRDPIAYRGGIIKLKIGPI
Ga0307515_100223642	3300028794	Ectomycorrhiza	LLAAVKRIGLLYRKKEQLYLLITILGDLIAYRGGIINLKTGPI
Ga0307515_100227082	3300028794	Ectomycorrhiza	MGLPYRQKEHSYLLVTILGDPIAYGGGIINLKTGPI
Ga0307515_100231791	3300028794	Ectomycorrhiza	MGLLYRKKEYLYLLVIILGDPIAYKGGIINLKIGPI
Ga0307515_100232161	3300028794	Ectomycorrhiza	MGLPHRQKEHPYLLVIILEDPIAYGGGIINLKIGPI
Ga0307515_100232464	3300028794	Ectomycorrhiza	AAVKRIGLLYRKKECLYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_100238731	3300028794	Ectomycorrhiza	VVKRIGLPYRKKEYPYLLITILGDLIAYKGGIINLKTGPI
Ga0307515_100241942	3300028794	Ectomycorrhiza	MGLPHRKKEHPYLLVIILGDPIAYGEGIINLKIGPI
Ga0307515_100243571	3300028794	Ectomycorrhiza	MGLPYRRKEHLYLLVTILEDLIAYRDSIINLKIGPI
Ga0307515_100244912	3300028794	Ectomycorrhiza	LLAVVKRIGLLYKKKECPYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100248482	3300028794	Ectomycorrhiza	MGLLYKKKKHLYLLVTILGDLIAYRGGIINLKIRPI
Ga0307515_100249363	3300028794	Ectomycorrhiza	LLAVDKKIGLPYRKKEHSYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_100253401	3300028794	Ectomycorrhiza	MGLPHRQKEHPYLLVTILGDAIAYRGGIINLKTGPI
Ga0307515_100254081	3300028794	Ectomycorrhiza	MGLLYRKKECPYLLVTILGDPIAYRGGIINLKTGPI
Ga0307515_100254911	3300028794	Ectomycorrhiza	MGLLYRQKEHPYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100262741	3300028794	Ectomycorrhiza	MGLPHRQKECPYLLVTILGDPIAYGGGIINLKIGLI
Ga0307515_100264293	3300028794	Ectomycorrhiza	MGLPYRQKEKPYLLVTILGDLITYGGGIINLKIGPI
Ga0307515_100266801	3300028794	Ectomycorrhiza	MGLPYRKKEHSYLLVIILGDPIAYRGGIINLKTGPI
Ga0307515_100271113	3300028794	Ectomycorrhiza	MGLLHRRKEHLYLLVIILGDPIAYRDSIINLKTGPI
Ga0307515_100275311	3300028794	Ectomycorrhiza	LLVVVKRIGLPYRQKEQPYLLVTILGDLIAYGGGIISLKIGPI
Ga0307515_100276561	3300028794	Ectomycorrhiza	MGLPYRQKEEPYLLVTILGDPIAYRGGIINLKIGPI
Ga0307515_100279481	3300028794	Ectomycorrhiza	VVVKRMGLLYRRKEHLYLLVIILGDPIAYRDGIINLKIGPI
Ga0307515_100281172	3300028794	Ectomycorrhiza	LLIAVRRIGLLYKEKEHPYLLVIILGDPIAYGGGIINLKTGPI
Ga0307515_100281853	3300028794	Ectomycorrhiza	LLAAVKRIGLPYRKKEHPYLLVTILGDLIAYRGGITNPKTGPI
Ga0307515_100288861	3300028794	Ectomycorrhiza	MGLLYRKKEYLYLLVTILGDPIAYRGGIINLKIEPI
Ga0307515_100289931	3300028794	Ectomycorrhiza	MGLPYRKREYPYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100296111	3300028794	Ectomycorrhiza	MGLPYREKEHPYLLVTILGDLIAYGGGIINLKTGPI
Ga0307515_100308501	3300028794	Ectomycorrhiza	MGLLYRKKKCPYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100310031	3300028794	Ectomycorrhiza	MGLLYRKKECLYLLVIILGDPIAYGGGIINLKIGPI
Ga0307515_100310611	3300028794	Ectomycorrhiza	MGLPHQKKECPYLLVTILGDLIAYRGGIINLKTGPI
Ga0307515_100311402	3300028794	Ectomycorrhiza	MGLLYRKKECSYLLVTILGDLIAYGGGIINLKIGPI
Ga0307515_100315052	3300028794	Ectomycorrhiza	MGLLYKKKEYPYLLVTILGDPIAYGGGIINLKIGPI
Ga0307515_100315942	3300028794	Ectomycorrhiza	MGLLYRKKEYSYLLVIILGDPIAYGGGIINLKIGPI
Ga0307515_100320031	3300028794	Ectomycorrhiza	MGLPYKQKEQPYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100324822	3300028794	Ectomycorrhiza	MGLLYRKKECLYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100329661	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLVIILEDLIAHRGGIINLKIGPI
Ga0307515_100332986	3300028794	Ectomycorrhiza	ILLVAVKRMGLLYRKKEYPYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100335672	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLVTILGDLIAYRGSIINLKTGPI
Ga0307515_100337461	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVTILGDLIAYGGGIINLKIGPI
Ga0307515_100356211	3300028794	Ectomycorrhiza	MGLPYRQKEEPYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100357031	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLVTILGDPIAYRGGIINLKIGPI
Ga0307515_100373111	3300028794	Ectomycorrhiza	MGLLYRQKEQSYLLVIILGDPIAYGGGIINLKIGPI
Ga0307515_100380341	3300028794	Ectomycorrhiza	LLAAVKRIGLPYRKKKCPYLLVTILGDPIAYRGGIINLKTGPI
Ga0307515_100385671	3300028794	Ectomycorrhiza	MGLPYRKKEHLYLLVIILEDLIAYRDGIINLKTGPI
Ga0307515_100406013	3300028794	Ectomycorrhiza	MGLPYRQKEQPYLLVIILGDLITYRGGIINFKIEPI
Ga0307515_100407442	3300028794	Ectomycorrhiza	MGLLHRRKEHLYLLVTILGDLIAYGDSIINLKTGPI
Ga0307515_100422541	3300028794	Ectomycorrhiza	MGLLYRKKESPYLLVTILGDPIAYKKGIINLKTGPI
Ga0307515_100429921	3300028794	Ectomycorrhiza	MGLLYRKKEHFYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100433631	3300028794	Ectomycorrhiza	MGLLYRKKEYFYLLVIILGDLIAYRGGIINLKTRPI
Ga0307515_100444681	3300028794	Ectomycorrhiza	MGLPHRKKEHPYLLVIISEDLIAYRGGIINLKTGPI
Ga0307515_100445233	3300028794	Ectomycorrhiza	MGLLYRKKAYSYLLVTILGDPIAYRGGIINLKTGPI
Ga0307515_100446581	3300028794	Ectomycorrhiza	MGLLHRRKEHLYLLVTILGDPIAYKDSIINLKTGPI
Ga0307515_100459501	3300028794	Ectomycorrhiza	MGLPYRKKEYPYLLVIILGDLIAYGGGIINLKIGPI
Ga0307515_100463461	3300028794	Ectomycorrhiza	MGLPYRKKEHPYLLILILGDLIAYRGGIINLKIGPIKLTIKGR
Ga0307515_100464181	3300028794	Ectomycorrhiza	MGLPYRKKEYSYLLVIILGDPIAYGGGIINLKTGPI
Ga0307515_100465641	3300028794	Ectomycorrhiza	MGLPHRKKKHPYLLVTILENPIAYRGGIINLKIGPIWLTIKGR
Ga0307515_100471432	3300028794	Ectomycorrhiza	MGLLHRKKEYPYLLIIILGDLIAYRGGIINLKIGPI
Ga0307515_100473641	3300028794	Ectomycorrhiza	LLVAVKRIELPYRKKEYPYLLVIILRDPIAYRGGIINLKIGPI
Ga0307515_100473661	3300028794	Ectomycorrhiza	MGLLYRKKEYSYLLVIILGDPIAYGGGIINLKIGLI
Ga0307515_100475961	3300028794	Ectomycorrhiza	MGLLYGKREHPYLLVTILGDLIAYRXGIINLKIGPI
Ga0307515_100484142	3300028794	Ectomycorrhiza	MGLPHRKKEYPYLLVTILGDLIAYRGGIINLKTGPI
Ga0307515_100489091	3300028794	Ectomycorrhiza	MGLLHRKKEYPYLLVTILGDPIAYRGGIINLKIGPI
Ga0307515_100490171	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLVIILGDLIAYRGGIINLETGPI
Ga0307515_100490471	3300028794	Ectomycorrhiza	MGLLYRKREQPYLLVIILGDPIAYRGGIISLKIGPI
Ga0307515_100491621	3300028794	Ectomycorrhiza	MGLLYRKKECSYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100498262	3300028794	Ectomycorrhiza	MGLPYRKKEYPYLLVTILGDLIAYGGGIINLKIGPI
Ga0307515_100503612	3300028794	Ectomycorrhiza	MGLPHRKKEYPYLLVIILGDPIAYGGGIINLKTGPI
Ga0307515_100508321	3300028794	Ectomycorrhiza	MGLPYRQKEEPYLLVTILGDLIAYGGGIINLKIGPI
Ga0307515_100517341	3300028794	Ectomycorrhiza	MGLLYRKKEYPYPLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100517731	3300028794	Ectomycorrhiza	MGLLYRRKEYLYLLVTILRDLIAYKDGIINLKTGPI
Ga0307515_100518571	3300028794	Ectomycorrhiza	LLAAVKRIGLPYRKKEHPYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100519031	3300028794	Ectomycorrhiza	MGLLHQKKEHLYLLVTILGDPIAYRGGIINLKTGPI
Ga0307515_100526362	3300028794	Ectomycorrhiza	MGLPYRKKECSYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100536912	3300028794	Ectomycorrhiza	MGLLYRKKECPYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100549613	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLIIILGDPIAYKGGIINLKTGPI
Ga0307515_100557601	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLIIILGDLIAYGGGIINLKIGPI
Ga0307515_100562001	3300028794	Ectomycorrhiza	MGLLHRKKECPYLLVIILGDPIAYGGGIINLKTGPI
Ga0307515_100567382	3300028794	Ectomycorrhiza	KKIGLLYRKKEYPYLLVIILGDLIAYKGGIINLKIEPI
Ga0307515_100568902	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVTILGDPIAYGGGIINLKIGPI
Ga0307515_100583681	3300028794	Ectomycorrhiza	MGLLYRQKERPYLLVIILGDLIAYRGGIINLKTGPI
Ga0307515_100591551	3300028794	Ectomycorrhiza	MGLPYRKKECPYLLVIILEDLIAYRGGIINLKIGPI
Ga0307515_100594901	3300028794	Ectomycorrhiza	MGLLYRKKEYSYLLVIILGDPIAYRGGIINLQTGFI
Ga0307515_100600011	3300028794	Ectomycorrhiza	VVKRIGLLYRKKEHPYLLVIILGDLIAYKGGIINLKIGPISLTIKGR
Ga0307515_100613471	3300028794	Ectomycorrhiza	MGLPHRRKEYLYLLVTILGDLIAYRDGIINLEIGPI
Ga0307515_100631812	3300028794	Ectomycorrhiza	LLAVVKRIGLLHRQKEYPYLLITILGDPIAYGGGIINLKIGPI
Ga0307515_100634351	3300028794	Ectomycorrhiza	MGLPYRKKECFYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100636031	3300028794	Ectomycorrhiza	MGLPYRKKEYLYLLVTILGDPIAYKESIINLKIGPI
Ga0307515_100640511	3300028794	Ectomycorrhiza	MGLPYRKKEYPYLLVTILGDPIAYGGGIINLKIGPI
Ga0307515_100642481	3300028794	Ectomycorrhiza	MGLLYRRKEHPYLLVTILGDLIAYRDSIINLKIGPIQLTIKRR
Ga0307515_100647611	3300028794	Ectomycorrhiza	MARLAVKKIGLLYRKKEYPYLLMIILEDPIAYKGGIINLKIGPI
Ga0307515_100656994	3300028794	Ectomycorrhiza	MGLLYRKKEHLYLLVTILGDLIAYRDGIINLKTGPI
Ga0307515_100662111	3300028794	Ectomycorrhiza	MGLPHRKKKYFYLLVTILGDPITYRGGIISLKIGPIQLTIKGR
Ga0307515_100665801	3300028794	Ectomycorrhiza	KRIGLLYRRKEHLYLLVTILGDLIAYRDGIINLKTGPI
Ga0307515_100696262	3300028794	Ectomycorrhiza	MGLPYRKKEHFYLLVIILGDLIAYRGGIINLKTGPI
Ga0307515_100700161	3300028794	Ectomycorrhiza	MELLHRRKEHLYLLVTILGDPIAYGDGIINLKIGPI
Ga0307515_100701222	3300028794	Ectomycorrhiza	LLIAVKRIGLLYRKKEYPYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100701711	3300028794	Ectomycorrhiza	MGLLYRRKEHLYLLVTILGDLIAYGDGIINLKIGPI
Ga0307515_100711031	3300028794	Ectomycorrhiza	MGLPYRKKEHPYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100712111	3300028794	Ectomycorrhiza	LLIVVKIIELPYKKKECPYLLVIILGDLIAYRGGIINFKIGPI
Ga0307515_100716262	3300028794	Ectomycorrhiza	MGLLYRRKEHLYLLVTILGDLIAYRDGIINLKIGPI
Ga0307515_100716281	3300028794	Ectomycorrhiza	MGLLHRKKECPYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_100723721	3300028794	Ectomycorrhiza	MGLPYRKKEYSYLLVMILGDLIAYGGGIINLKIRPI
Ga0307515_100726581	3300028794	Ectomycorrhiza	MGLLYRKKEYLYLLVTILGDPIAYKGGIINLKTGPI
Ga0307515_100738281	3300028794	Ectomycorrhiza	MGLPYRKKEYPYLLVTILGDLMAYGGGIINLKIGPI
Ga0307515_100750081	3300028794	Ectomycorrhiza	MGLLYRRKEYLYLLVTILEDLIAYGDGIINLKIGPI
Ga0307515_100763221	3300028794	Ectomycorrhiza	MGLLYRRKEYLYLLVIILGDLIAYRDGIINLKTGPI
Ga0307515_100764691	3300028794	Ectomycorrhiza	MGLLYRRKEYLYLLVTILGDPIAYKNSIINLKTGPI
Ga0307515_100774081	3300028794	Ectomycorrhiza	MGLPYRKKEYPYLLVTILGDLIAYRGGIINLKIGPI
Ga0307515_100783512	3300028794	Ectomycorrhiza	MGLPHKKKEHPYLLVIISGDLIAYGGGIINLKIGPI
Ga0307515_100793911	3300028794	Ectomycorrhiza	MGLLYRRKEYLYLLVTILEDLIAYRDGIINLKIGPI
Ga0307515_100799862	3300028794	Ectomycorrhiza	LLAAVKRMGLPHKKKEYPYLLVIILGDPIAYGGGIINLKIGPI
Ga0307515_100835121	3300028794	Ectomycorrhiza	MGLLYRKKEYLYLLVTILGDPIAYRGGIINLKTGPIQLTVKGR
Ga0307515_100838511	3300028794	Ectomycorrhiza	MGLLYRKKEYFYLLVTILGDPIAYRGGIINLKIGPI
Ga0307515_100846101	3300028794	Ectomycorrhiza	LLAAVKRIGLPHRKKECLYLLVTILGDPIAYGGGIINLKTGPI
Ga0307515_100850792	3300028794	Ectomycorrhiza	MGLPYRKKEYFYLLVIILGDLIAYRGGIINLRIGPI
Ga0307515_100855691	3300028794	Ectomycorrhiza	MGLLYRKKECFYLLVTILGDPIAYRGGIINLKTGPI
Ga0307515_100856941	3300028794	Ectomycorrhiza	LLVAVKKIGLPHRKKECPYLLMTILGDPIAYRGGIINLKTGPI
Ga0307515_100861781	3300028794	Ectomycorrhiza	MGLLYREKEHSYPLVTILGDLIAYGGGIINLKTGPI
Ga0307515_100880341	3300028794	Ectomycorrhiza	MGLLYRKKEHPYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_100889273	3300028794	Ectomycorrhiza	MGLLYRKKEHFYLLVIILKDLIAYRGGIINLKIEPI
Ga0307515_100890031	3300028794	Ectomycorrhiza	MGLLYRQKEHLYPLVIILGDPVAYRGGIINLKIGLI
Ga0307515_100898251	3300028794	Ectomycorrhiza	MGLLHRKKEHFYLLVIILGDLIAYRGGIINLKTGPI
Ga0307515_100902241	3300028794	Ectomycorrhiza	AAVKRIGLLYRKKEHPYPLVIILGDLIAYRGGIINLKTGPIRLTIKGR
Ga0307515_100917481	3300028794	Ectomycorrhiza	LLAAVKRIGLPHRQKKHPYLLVTISGDLIAYKGGIINLKTGPI
Ga0307515_100925091	3300028794	Ectomycorrhiza	MGLPYRQKEQLYLLVTILGDPITYRGGIINLEIGPI
Ga0307515_100944732	3300028794	Ectomycorrhiza	MGLLYREKEHPYLLVIILEDLIAYRGGIINLKIGPI
Ga0307515_100975061	3300028794	Ectomycorrhiza	MGLLYRKKECPYLLVTILEDPIAYRGGIINLKIGPI
Ga0307515_100982781	3300028794	Ectomycorrhiza	MGLLYRKKEHLYLLVTILEDLIAYRDSIINFKIEPI
Ga0307515_100989221	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVTILGDLIAYRGGIINLKTGPI
Ga0307515_101006441	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVTILEDLIAYRGGIINLKIGPI
Ga0307515_101006781	3300028794	Ectomycorrhiza	MGLLYRKKKYPYLLVIILGDLIAYRGGIINLKTGPI
Ga0307515_101006921	3300028794	Ectomycorrhiza	MGLLYRKKEYFYLLITILGDLIAYRGSIINLKTGPI
Ga0307515_101012532	3300028794	Ectomycorrhiza	MGLLYRKKEYFYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_101054422	3300028794	Ectomycorrhiza	LLTAVKKIGLLYRQKERPYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_101074031	3300028794	Ectomycorrhiza	LLAAVKKIGLLYRKKECSYLLVIILGDPIAYGGGIINLKTGPI
Ga0307515_101114582	3300028794	Ectomycorrhiza	LLIAVKRIGLLYRKKEYPYLLVIILGDPIAYRGGIINLKIEPI
Ga0307515_101136581	3300028794	Ectomycorrhiza	MGLLYKRKEHLYLLVIILKDLIAYRDGIINLKIGPI
Ga0307515_101141471	3300028794	Ectomycorrhiza	MGLLYRRKEHLYLLVTILEDLIAYRDGIINLKIGPI
Ga0307515_101175381	3300028794	Ectomycorrhiza	MGLLYRKKEHLYLLVIILEDLIAYRDGIINLKIGPI
Ga0307515_101219711	3300028794	Ectomycorrhiza	MGLLYRKKEYFYLLVTILGDPIAYRGGIINLKTGPIQITIKGR
Ga0307515_101252111	3300028794	Ectomycorrhiza	GLLYRKKEYPYLLVIILGDLIAYGGGIINFKIGLI
Ga0307515_101258201	3300028794	Ectomycorrhiza	LLAAVKKIGLPYRKKKYPYLLVTILGDLIAYGGGIINLKTGPI
Ga0307515_101301861	3300028794	Ectomycorrhiza	MGLPYRKKEYFYLLVTILGDLIAYGGGIINLKTGPI
Ga0307515_101302401	3300028794	Ectomycorrhiza	MGLLHRRKKYFYLLVIILGDPIAYKGSIINLKIGPI
Ga0307515_101321021	3300028794	Ectomycorrhiza	MGLLYREKEYSYLLVIILGDLIAYRGGFINLKIGPI
Ga0307515_101362851	3300028794	Ectomycorrhiza	MGLLYRKKEYFYLLVTILGDPIAYRGGIINLKTGPI
Ga0307515_101365941	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_101381381	3300028794	Ectomycorrhiza	MGLPYRKKEYFYLLVIILGDPIAYRGGIINLKTGPI
Ga0307515_101428301	3300028794	Ectomycorrhiza	MGLLYRRKEHLYLLVTISRDLIAYGNGIINFKIGPI
Ga0307515_101442261	3300028794	Ectomycorrhiza	MGLPYRQKEQLYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_101468221	3300028794	Ectomycorrhiza	MGLLYRRKEYLYLLVTILGDLIAYRDSIINLKIGPI
Ga0307515_101486071	3300028794	Ectomycorrhiza	MGLLYRQKERSYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_101605191	3300028794	Ectomycorrhiza	MGLLYKKKEYLYLLVTILEDLIAYKDSIINLKTGPI
Ga0307515_101808781	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVIILGDPIAYRGSIINLKIGPI
Ga0307515_101822871	3300028794	Ectomycorrhiza	LLAAVKGVGLLYRKKEYPYLLVIILGDPIAYRGGIINLKTGPI
Ga0307515_102079261	3300028794	Ectomycorrhiza	LLIAVKRMGLLYRKKEYPYLLVIILGDLIAYKGDIINLKIGPI
Ga0307515_102091901	3300028794	Ectomycorrhiza	LLAAVKRIGLLYRKKEYFYLLIIILGDPIAYRGGIINLKIGPI
Ga0307515_102104621	3300028794	Ectomycorrhiza	LLVVVKRIGLPHRKKEYPYLLVTILGDPIAYRGGIINLKTGPI
Ga0307515_102275901	3300028794	Ectomycorrhiza	MGLLHRRKEHLYLLVIILGDLIAYRDGIINLKTGPI
Ga0307515_102359262	3300028794	Ectomycorrhiza	MGLLYRKKEYFYLLVIILGDLIAYGGGIINLKMGPI
Ga0307515_102432761	3300028794	Ectomycorrhiza	LLVVVKRIGLLYRKKKYFYLLVTILEDPIAYRGGIINFKIEPI
Ga0307515_102496541	3300028794	Ectomycorrhiza	MGLLYRKKEYSYLLVTVFGDLITYRGGIINLKIGPI
Ga0307515_102553491	3300028794	Ectomycorrhiza	MGLLYRKKECSYLLIIILGDLIAYREGIINLKIGPI
Ga0307515_102576271	3300028794	Ectomycorrhiza	MGLPYRKKECPYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_103023841	3300028794	Ectomycorrhiza	LLVAVKRIGLLYRKKECPYLLVIILGDPIAYRGGIINLKTGLI
Ga0307515_103766711	3300028794	Ectomycorrhiza	KKIGLPHRKKECLYLLVIILGDLIAYRGGIINLKIGPI
Ga0307515_103846011	3300028794	Ectomycorrhiza	MGLLYRKKEYPYLLVIILGDLIAYKGDIINLKIGPI
Ga0307515_103906161	3300028794	Ectomycorrhiza	GIPHRKKECLYLLVIILGDPIAYRGGIINLKIGPI
Ga0307515_104430261	3300028794	Ectomycorrhiza	YISLIVVKRIGLPHRKKEYLYLLVIILGDPISYRGGIINLKTGPI
Ga0307515_107546151	3300028794	Ectomycorrhiza	KRIGLLYRRKEHLYLLVIILGNLIAYRDSIINFKTRPI
Ga0307515_107571471	3300028794	Ectomycorrhiza	MGLPYRKKECPYLLVTILGDPIAYRGGIINLKIGPI
Ga0307515_107893671	3300028794	Ectomycorrhiza	LLVAVKRIGLLYRKKEYPYLLVTILGDPIAYGGGIINLKIGPI
Ga0307512_102418681	3300030522	Ectomycorrhiza	MGLPHRQKEHLYLLLTISGDPIAYRGGIINLKTGPI
Ga0307512_104232081	3300030522	Ectomycorrhiza	MGLLYRQKEHLYLLITILGDQIAYRGGIINLKIGPI
Ga0170820_142631571	3300031446	Forest Soil	MGLPHRQKERPYLLIIILGDPIAYRGGIINLKTGPI
Ga0307518_101717571	3300031838	Ectomycorrhiza	MTYRQKEHLYLLIIILKKLINYKGGVINIEIEIIIIKI
Ga0307518_102806331	3300031838	Ectomycorrhiza	NIIYREKEYLYLLVIILRDLINYRGGIINIKIGLVII
Ga0307518_102986031	3300031838	Ectomycorrhiza	MVKWLGMIYQQKEYLYLLNIILKDLINYKGDIINLEI
Ga0307518_105832101	3300031838	Ectomycorrhiza	ICKQKEHLYLLIIILKNFINHKGGIINLEIGLVII
Ga0307507_1000005847	3300033179	Ectomycorrhiza	MGLLYRQKEYLYLLITILGDLIAYRGGIINLKIGPI
Ga0307507_1000006529	3300033179	Ectomycorrhiza	MGLPYRQKEYLYPLIIILGDLIAYRGGIINLKTGPI
Ga0307507_1000016618	3300033179	Ectomycorrhiza	VERIGLLYRQKEHLYPLITILGDQIAYGKGIINLKTGPI
Ga0307507_1000024510	3300033179	Ectomycorrhiza	MGLLYRQKEYLYLLIINLEDLIAYRGGISNLKIGPI
Ga0307507_1000034740	3300033179	Ectomycorrhiza	MGLLYKQKEHLYLLITISGDQIAYKGGVINLKTEPI
Ga0307507_1000038415	3300033179	Ectomycorrhiza	MLLVAVKRIGLLNRQEEYLYLLIMILGDLIAYRGGIINLKIGPI
Ga0307507_1000042142	3300033179	Ectomycorrhiza	MGLLYKQKEYLYPLITISGDQIAYKGGIINLKIGPI
Ga0307507_1000055429	3300033179	Ectomycorrhiza	MLLKAVKKIGLPYRQKEHLYPLITISGDQIAYKGGIINLKTGPI
Ga0307507_1000096412	3300033179	Ectomycorrhiza	MGLLYRQKEHLYLLIIILGDLIAYGGGIINLKIGLI
Ga0307507_100009706	3300033179	Ectomycorrhiza	MGLLYRQKEYLYLLITILGDPIAYRGGIINLKIGPI
Ga0307507_100010068	3300033179	Ectomycorrhiza	MGLLYRQKEHLYLLIMILGDLIAYRGGIIDLETGPI
Ga0307507_1000188510	3300033179	Ectomycorrhiza	MGLLYRQKEHLYLLITILGDPIAYKGGVINLKTGPV
Ga0307507_100020062	3300033179	Ectomycorrhiza	MGLLYRQKEHLYLLITILGDQIAYKGGIINLKIGPI
Ga0307507_100033377	3300033179	Ectomycorrhiza	MGLLYRQKEYLYLLIIILGDLIAYKGGIINLKIEPI
Ga0307507_100036874	3300033179	Ectomycorrhiza	MGLPYRQKEYLYLLVTILEDQIVYKGGIINLKIGPI
Ga0307507_100047861	3300033179	Ectomycorrhiza	MGLLYRQKEYLYLLIIILGDLIAYKGGIINHKIGPI
Ga0307507_100154632	3300033179	Ectomycorrhiza	MLLVAVKRIGLLYRQKEYLYLLITILEDLIAYRGGIINLKIGLI
Ga0307507_100180752	3300033179	Ectomycorrhiza	MLLIAVERIGLLYRQKEHLYPLIMILGDPIAYRRGIINLKIGLI
Ga0307507_100284431	3300033179	Ectomycorrhiza	MGLPHRQKEYLYLLIMILGDLIAYRGGIINLKIGPI
Ga0307507_102391951	3300033179	Ectomycorrhiza	MGLPHRQKEQPYLLVTILGDLITYGGGIINLKTGPI
Ga0307507_102931021	3300033179	Ectomycorrhiza	MGLLYRQKEQSYLLVIILGDLITYRGGIINLKTGPI
Ga0307507_103783472	3300033179	Ectomycorrhiza	MGLPYRQKKSPYPLITISGDPILYRNNIIHLKTES
Ga0307507_104247631	3300033179	Ectomycorrhiza	AIQKMGLFYRQKQNLYLLVTILGNPISYRNGVIYFKTGPVQITVKG
Ga0307507_104334541	3300033179	Ectomycorrhiza	MGLSYRQKANPYLLVTILGDPILYGDNIIYFKTGPIEVIIKE
Ga0307507_104396471	3300033179	Ectomycorrhiza	IELPHRQKENPYLLVIILGDLIIYRGGIINLKIGPI
Ga0307507_104986382	3300033179	Ectomycorrhiza	MGLLYRQKEQPYLLVTILGDLIAYKGGIINLKIGPI
Ga0307507_105134851	3300033179	Ectomycorrhiza	KRIGLPYRQKERSYLLVTILGDLIAYGGGIINLKTGPI
Ga0307507_106783481	3300033179	Ectomycorrhiza	LAAIKRIGLPYRQKEQSYLLVTILGDLITYRGGIINLKIGPI
Ga0307507_106835911	3300033179	Ectomycorrhiza	VVKRIGLPYRQKRQSYLLVTILGDLITYGGGIINLKIGPI

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F008599

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign