NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F008378

Metagenome / Metatranscriptome Family F008378

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F008378
Family Type Metagenome / Metatranscriptome
Number of Sequences 334
Average Sequence Length 40 residues
Representative Sequence PAPYGSVGVDINCAVIGFTAKAPTANLAEPAPNSQFPPR
Number of Associated Samples 245
Number of Associated Scaffolds 334

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.20 %
% of genes near scaffold ends (potentially truncated) 98.80 %
% of genes from short scaffolds (< 2000 bps) 91.02 %
Associated GOLD sequencing projects 228
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.132 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(16.168 % of family members)
Environment Ontology (ENVO) Unclassified
(27.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.916 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 334 Family Scaffolds
PF04248NTP_transf_9 9.58
PF03358FMN_red 5.09
PF00578AhpC-TSA 4.79
PF03640Lipoprotein_15 2.69
PF01227GTP_cyclohydroI 2.40
PF00196GerE 1.80
PF00106adh_short 1.50
PF04199Cyclase 1.20
PF07992Pyr_redox_2 1.20
PF03176MMPL 1.20
PF13191AAA_16 0.90
PF02518HATPase_c 0.90
PF03992ABM 0.90
PF04264YceI 0.90
PF00903Glyoxalase 0.90
PF13561adh_short_C2 0.90
PF14224DUF4331 0.60
PF00561Abhydrolase_1 0.60
PF02467Whib 0.60
PF14534DUF4440 0.60
PF04542Sigma70_r2 0.60
PF00440TetR_N 0.60
PF01927Mut7-C 0.60
PF01145Band_7 0.60
PF02627CMD 0.60
PF05988DUF899 0.30
PF03965Penicillinase_R 0.30
PF03631Virul_fac_BrkB 0.30
PF00296Bac_luciferase 0.30
PF08125Mannitol_dh_C 0.30
PF11774Lsr2 0.30
PF06689zf-C4_ClpX 0.30
PF13508Acetyltransf_7 0.30
PF10282Lactonase 0.30
PF13683rve_3 0.30
PF11716MDMPI_N 0.30
PF07883Cupin_2 0.30
PF08240ADH_N 0.30
PF00202Aminotran_3 0.30
PF07690MFS_1 0.30
PF04185Phosphoesterase 0.30
PF09948DUF2182 0.30
PF01915Glyco_hydro_3_C 0.30
PF03807F420_oxidored 0.30
PF03466LysR_substrate 0.30
PF00126HTH_1 0.30
PF13490zf-HC2 0.30
PF14104DUF4277 0.30
PF00072Response_reg 0.30
PF06441EHN 0.30
PF067253D 0.30
PF02852Pyr_redox_dim 0.30
PF06736TMEM175 0.30
PF06965Na_H_antiport_1 0.30
PF00496SBP_bac_5 0.30
PF08281Sigma70_r4_2 0.30
PF12680SnoaL_2 0.30
PF01569PAP2 0.30
PF00107ADH_zinc_N 0.30
PF04964Flp_Fap 0.30
PF00892EamA 0.30
PF00486Trans_reg_C 0.30
PF01494FAD_binding_3 0.30
PF03473MOSC 0.30
PF13280WYL 0.30
PF13177DNA_pol3_delta2 0.30
PF05088Bac_GDH 0.30
PF00378ECH_1 0.30
PF03372Exo_endo_phos 0.30
PF01135PCMT 0.30

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 334 Family Scaffolds
COG2343Uncharacterized conserved protein, DUF427 familyFunction unknown [S] 9.58
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 2.69
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 1.20
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 1.20
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 1.20
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.90
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.60
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.60
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.60
COG1656Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domainGeneral function prediction only [R] 0.60
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.60
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.60
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.60
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.60
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.30
COG0246Mannitol-1-phosphate/altronate dehydrogenasesCarbohydrate transport and metabolism [G] 0.30
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.30
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.30
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.30
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 0.30
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 0.30
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.30
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.30
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.30
COG2902NAD-specific glutamate dehydrogenaseAmino acid transport and metabolism [E] 0.30
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.30
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.30
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.30
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.30
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.30
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.30
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.30
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.30
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.30


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.13 %
UnclassifiedrootN/A15.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02FQ7GYAll Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
2209111022|2221208372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus982Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0739307All Organisms → cellular organisms → Bacteria1795Open in IMG/M
3300000956|JGI10216J12902_101931269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2560Open in IMG/M
3300000956|JGI10216J12902_105901866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia913Open in IMG/M
3300000956|JGI10216J12902_106305644All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300000956|JGI10216J12902_111223541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11693Open in IMG/M
3300001867|JGI12627J18819_10267156Not Available688Open in IMG/M
3300002568|C688J35102_119340692All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005183|Ga0068993_10054679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1173Open in IMG/M
3300005434|Ga0070709_10000935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia16205Open in IMG/M
3300005434|Ga0070709_11618717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11527Open in IMG/M
3300005435|Ga0070714_101741649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium608Open in IMG/M
3300005437|Ga0070710_10045152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2448Open in IMG/M
3300005445|Ga0070708_101422668All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300005455|Ga0070663_100514652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11996Open in IMG/M
3300005467|Ga0070706_100978111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium781Open in IMG/M
3300005467|Ga0070706_101294682Not Available668Open in IMG/M
3300005468|Ga0070707_100585111All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300005468|Ga0070707_101087448Not Available765Open in IMG/M
3300005468|Ga0070707_101744678Not Available590Open in IMG/M
3300005471|Ga0070698_100577927Not Available1064Open in IMG/M
3300005471|Ga0070698_101737326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales576Open in IMG/M
3300005471|Ga0070698_101968250All Organisms → cellular organisms → Bacteria → Terrabacteria group537Open in IMG/M
3300005518|Ga0070699_101848418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300005526|Ga0073909_10672203Not Available517Open in IMG/M
3300005534|Ga0070735_10368998All Organisms → cellular organisms → Bacteria → Terrabacteria group861Open in IMG/M
3300005535|Ga0070684_100993631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia787Open in IMG/M
3300005540|Ga0066697_10636721All Organisms → cellular organisms → Bacteria → Terrabacteria group588Open in IMG/M
3300005542|Ga0070732_10573164Not Available685Open in IMG/M
3300005556|Ga0066707_11022559All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium503Open in IMG/M
3300005557|Ga0066704_10382782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300005557|Ga0066704_10679242All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300005557|Ga0066704_10881975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium554Open in IMG/M
3300005559|Ga0066700_10991767All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005560|Ga0066670_10331878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia926Open in IMG/M
3300005561|Ga0066699_11247573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus510Open in IMG/M
3300005575|Ga0066702_10729770Not Available590Open in IMG/M
3300005576|Ga0066708_10317877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter998Open in IMG/M
3300005616|Ga0068852_101893955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus619Open in IMG/M
3300005764|Ga0066903_101362655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1330Open in IMG/M
3300005764|Ga0066903_105049643All Organisms → cellular organisms → Bacteria → Terrabacteria group700Open in IMG/M
3300005764|Ga0066903_106029570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300005843|Ga0068860_102184334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus574Open in IMG/M
3300006028|Ga0070717_10184531All Organisms → cellular organisms → Bacteria1820Open in IMG/M
3300006028|Ga0070717_10865843All Organisms → cellular organisms → Bacteria → Terrabacteria group822Open in IMG/M
3300006028|Ga0070717_11215797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300006028|Ga0070717_11645167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium581Open in IMG/M
3300006032|Ga0066696_10257205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1129Open in IMG/M
3300006046|Ga0066652_102065725All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006173|Ga0070716_100029508All Organisms → cellular organisms → Bacteria2966Open in IMG/M
3300006175|Ga0070712_100296233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_111308Open in IMG/M
3300006175|Ga0070712_100647539Not Available898Open in IMG/M
3300006175|Ga0070712_101270735Not Available641Open in IMG/M
3300006358|Ga0068871_100755306All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300006755|Ga0079222_10266572All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300006796|Ga0066665_11463065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi531Open in IMG/M
3300006800|Ga0066660_11580401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300006804|Ga0079221_10885422All Organisms → cellular organisms → Bacteria → Terrabacteria group653Open in IMG/M
3300006806|Ga0079220_10125799All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300006844|Ga0075428_100367144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1544Open in IMG/M
3300006852|Ga0075433_10106215All Organisms → cellular organisms → Bacteria2488Open in IMG/M
3300006852|Ga0075433_11188993Not Available662Open in IMG/M
3300006854|Ga0075425_100346358Not Available1711Open in IMG/M
3300006854|Ga0075425_102100535Not Available630Open in IMG/M
3300006871|Ga0075434_100456655All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300006903|Ga0075426_10166591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1592Open in IMG/M
3300006903|Ga0075426_10667751All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300006903|Ga0075426_11245032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11564Open in IMG/M
3300006903|Ga0075426_11253589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11563Open in IMG/M
3300006903|Ga0075426_11340865Not Available543Open in IMG/M
3300006904|Ga0075424_100256751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1858Open in IMG/M
3300006904|Ga0075424_101580029Not Available696Open in IMG/M
3300006904|Ga0075424_102804649Not Available508Open in IMG/M
3300006954|Ga0079219_10081020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1525Open in IMG/M
3300009012|Ga0066710_100462703All Organisms → cellular organisms → Bacteria1904Open in IMG/M
3300009038|Ga0099829_10767551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium801Open in IMG/M
3300009038|Ga0099829_10837876All Organisms → cellular organisms → Bacteria → Terrabacteria group763Open in IMG/M
3300009088|Ga0099830_10834925All Organisms → cellular organisms → Bacteria → Terrabacteria group761Open in IMG/M
3300009090|Ga0099827_10296903All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300009090|Ga0099827_10731971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus855Open in IMG/M
3300009090|Ga0099827_11316433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi629Open in IMG/M
3300009100|Ga0075418_11803654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11665Open in IMG/M
3300009137|Ga0066709_101345697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_111043Open in IMG/M
3300009143|Ga0099792_10141444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1316Open in IMG/M
3300009143|Ga0099792_10823102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11610Open in IMG/M
3300009147|Ga0114129_10113101All Organisms → cellular organisms → Bacteria3744Open in IMG/M
3300009147|Ga0114129_11657295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11781Open in IMG/M
3300009147|Ga0114129_11727493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11763Open in IMG/M
3300009162|Ga0075423_10539660All Organisms → cellular organisms → Bacteria → Terrabacteria group1228Open in IMG/M
3300009162|Ga0075423_13212596Not Available501Open in IMG/M
3300009174|Ga0105241_10927335All Organisms → cellular organisms → Bacteria → Terrabacteria group810Open in IMG/M
3300009174|Ga0105241_11025803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus773Open in IMG/M
3300009177|Ga0105248_10928715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora983Open in IMG/M
3300009522|Ga0116218_1161376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus1016Open in IMG/M
3300009698|Ga0116216_10149940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1434Open in IMG/M
3300009698|Ga0116216_10774709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium575Open in IMG/M
3300009792|Ga0126374_11343429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica579Open in IMG/M
3300009809|Ga0105089_1025388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300009816|Ga0105076_1102816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia alpina556Open in IMG/M
3300010040|Ga0126308_11252535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium526Open in IMG/M
3300010043|Ga0126380_11611708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300010045|Ga0126311_10447148All Organisms → cellular organisms → Bacteria → Terrabacteria group1002Open in IMG/M
3300010046|Ga0126384_11452885All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300010048|Ga0126373_12122858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11623Open in IMG/M
3300010048|Ga0126373_12765653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300010048|Ga0126373_12781554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora546Open in IMG/M
3300010360|Ga0126372_11445977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica721Open in IMG/M
3300010360|Ga0126372_13067112Not Available518Open in IMG/M
3300010361|Ga0126378_12111965All Organisms → cellular organisms → Bacteria → Terrabacteria group642Open in IMG/M
3300010371|Ga0134125_10388734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1547Open in IMG/M
3300010371|Ga0134125_11551133All Organisms → cellular organisms → Bacteria → Terrabacteria group721Open in IMG/M
3300010373|Ga0134128_11050361All Organisms → cellular organisms → Bacteria → Acidobacteria900Open in IMG/M
3300010375|Ga0105239_11247584All Organisms → cellular organisms → Bacteria → Terrabacteria group857Open in IMG/M
3300010375|Ga0105239_12509061Not Available601Open in IMG/M
3300010376|Ga0126381_102574597All Organisms → cellular organisms → Bacteria → Terrabacteria group728Open in IMG/M
3300010379|Ga0136449_101214939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus1185Open in IMG/M
3300010396|Ga0134126_12173982Not Available605Open in IMG/M
3300010398|Ga0126383_13592443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11506Open in IMG/M
3300010401|Ga0134121_10128538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2145Open in IMG/M
3300010876|Ga0126361_10250680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300011270|Ga0137391_10161628All Organisms → cellular organisms → Bacteria1952Open in IMG/M
3300012045|Ga0136623_10040405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2028Open in IMG/M
3300012096|Ga0137389_11833826All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40502Open in IMG/M
3300012199|Ga0137383_10128405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK1851Open in IMG/M
3300012199|Ga0137383_10268011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Thermosporotrichaceae → Thermosporothrix1251Open in IMG/M
3300012199|Ga0137383_10701686Not Available739Open in IMG/M
3300012199|Ga0137383_11037637Not Available596Open in IMG/M
3300012200|Ga0137382_10034084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3071Open in IMG/M
3300012200|Ga0137382_10474700All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium887Open in IMG/M
3300012200|Ga0137382_11303404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300012201|Ga0137365_10025680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4548Open in IMG/M
3300012201|Ga0137365_10164922All Organisms → cellular organisms → Bacteria1661Open in IMG/M
3300012201|Ga0137365_10448620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora950Open in IMG/M
3300012202|Ga0137363_11736444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium517Open in IMG/M
3300012203|Ga0137399_10497081All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300012204|Ga0137374_10344348All Organisms → cellular organisms → Bacteria → Terrabacteria group1204Open in IMG/M
3300012206|Ga0137380_11609564All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300012207|Ga0137381_10914191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi758Open in IMG/M
3300012209|Ga0137379_11508274All Organisms → cellular organisms → Bacteria → Terrabacteria group573Open in IMG/M
3300012209|Ga0137379_11515483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium571Open in IMG/M
3300012210|Ga0137378_10195660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK1881Open in IMG/M
3300012210|Ga0137378_10961202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus768Open in IMG/M
3300012211|Ga0137377_10161773Not Available2147Open in IMG/M
3300012211|Ga0137377_10345716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1424Open in IMG/M
3300012211|Ga0137377_11267885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11667Open in IMG/M
3300012211|Ga0137377_11270915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium666Open in IMG/M
3300012212|Ga0150985_117928695All Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300012350|Ga0137372_10661982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium760Open in IMG/M
3300012351|Ga0137386_10060747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2624Open in IMG/M
3300012351|Ga0137386_10283392All Organisms → cellular organisms → Bacteria → Terrabacteria group1192Open in IMG/M
3300012356|Ga0137371_10151528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1818Open in IMG/M
3300012357|Ga0137384_10705071All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300012358|Ga0137368_10082670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2554Open in IMG/M
3300012358|Ga0137368_10222106All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300012360|Ga0137375_11363899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300012362|Ga0137361_10422244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1225Open in IMG/M
3300012362|Ga0137361_10434921All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300012362|Ga0137361_11125720All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300012362|Ga0137361_11461645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium606Open in IMG/M
3300012363|Ga0137390_11244216All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300012532|Ga0137373_10941631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300012678|Ga0136615_10485757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium531Open in IMG/M
3300012884|Ga0157300_1115740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300012915|Ga0157302_10445921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300012927|Ga0137416_10559470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae992Open in IMG/M
3300012930|Ga0137407_10148619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2068Open in IMG/M
3300012930|Ga0137407_10686583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria964Open in IMG/M
3300012951|Ga0164300_11172645All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012955|Ga0164298_10118382Not Available1434Open in IMG/M
3300012975|Ga0134110_10398763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11610Open in IMG/M
3300012976|Ga0134076_10197616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300012984|Ga0164309_11533128All Organisms → cellular organisms → Bacteria → Terrabacteria group570Open in IMG/M
3300012988|Ga0164306_11937259All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300013105|Ga0157369_11633420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora655Open in IMG/M
3300013296|Ga0157374_10492084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1230Open in IMG/M
3300013306|Ga0163162_11050409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus922Open in IMG/M
3300013307|Ga0157372_12576546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300014301|Ga0075323_1087655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300014497|Ga0182008_10124872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1281Open in IMG/M
3300014745|Ga0157377_11039584Not Available623Open in IMG/M
3300015084|Ga0167654_1056366All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300015264|Ga0137403_10435045All Organisms → cellular organisms → Bacteria → Terrabacteria group1188Open in IMG/M
3300015372|Ga0132256_100890481All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300016270|Ga0182036_11308479All Organisms → cellular organisms → Bacteria → Terrabacteria group605Open in IMG/M
3300016371|Ga0182034_10049731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella2761Open in IMG/M
3300017928|Ga0187806_1090552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria968Open in IMG/M
3300017936|Ga0187821_10344544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300017937|Ga0187809_10330972All Organisms → cellular organisms → Bacteria → Terrabacteria group567Open in IMG/M
3300017940|Ga0187853_10339782All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300017942|Ga0187808_10299846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii724Open in IMG/M
3300017973|Ga0187780_11036216Not Available599Open in IMG/M
3300017974|Ga0187777_10648148All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300018018|Ga0187886_1293414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300018026|Ga0187857_10228755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300018032|Ga0187788_10536669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11510Open in IMG/M
3300018038|Ga0187855_10746302Not Available570Open in IMG/M
3300018433|Ga0066667_10108664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1866Open in IMG/M
3300018433|Ga0066667_11009335Not Available718Open in IMG/M
3300019881|Ga0193707_1203595Not Available503Open in IMG/M
3300019887|Ga0193729_1039248All Organisms → cellular organisms → Bacteria1964Open in IMG/M
3300019890|Ga0193728_1000495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria19063Open in IMG/M
3300020579|Ga0210407_10459261All Organisms → cellular organisms → Bacteria → Terrabacteria group996Open in IMG/M
3300020580|Ga0210403_11138624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora604Open in IMG/M
3300021088|Ga0210404_10007881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4302Open in IMG/M
3300021170|Ga0210400_10346697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus1223Open in IMG/M
3300021170|Ga0210400_11619780All Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300021171|Ga0210405_11110968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium590Open in IMG/M
3300021362|Ga0213882_10059041Not Available1525Open in IMG/M
3300021363|Ga0193699_10213932Not Available801Open in IMG/M
3300021377|Ga0213874_10279324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11623Open in IMG/M
3300021388|Ga0213875_10109152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1292Open in IMG/M
3300021401|Ga0210393_11257712All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300021407|Ga0210383_10196196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica1725Open in IMG/M
3300021407|Ga0210383_10929319All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300021432|Ga0210384_10192760All Organisms → cellular organisms → Bacteria1831Open in IMG/M
3300021478|Ga0210402_10550239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora1071Open in IMG/M
3300021479|Ga0210410_10188610All Organisms → cellular organisms → Bacteria1845Open in IMG/M
3300021510|Ga0222621_1119612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300021559|Ga0210409_10087491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2880Open in IMG/M
3300021559|Ga0210409_10140314All Organisms → cellular organisms → Bacteria2217Open in IMG/M
3300022561|Ga0212090_10285348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Brevibacteriaceae → Brevibacterium1297Open in IMG/M
3300024330|Ga0137417_1382751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1231Open in IMG/M
3300025321|Ga0207656_10354465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus733Open in IMG/M
3300025580|Ga0210138_1141339All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300025898|Ga0207692_10585017Not Available716Open in IMG/M
3300025898|Ga0207692_10847399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora599Open in IMG/M
3300025906|Ga0207699_10746844Not Available718Open in IMG/M
3300025906|Ga0207699_11332457All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300025906|Ga0207699_11458054Not Available506Open in IMG/M
3300025911|Ga0207654_10697785Not Available729Open in IMG/M
3300025915|Ga0207693_10175310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1687Open in IMG/M
3300025915|Ga0207693_10270978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1330Open in IMG/M
3300025915|Ga0207693_10651646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium818Open in IMG/M
3300025915|Ga0207693_11031747Not Available627Open in IMG/M
3300025922|Ga0207646_10169274All Organisms → cellular organisms → Bacteria1973Open in IMG/M
3300025928|Ga0207700_10496995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1079Open in IMG/M
3300025928|Ga0207700_11588528All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300025928|Ga0207700_11650064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium566Open in IMG/M
3300025929|Ga0207664_10225940All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300025929|Ga0207664_10289962All Organisms → cellular organisms → Bacteria1438Open in IMG/M
3300025939|Ga0207665_10022628Not Available4137Open in IMG/M
3300025939|Ga0207665_10298540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1203Open in IMG/M
3300025949|Ga0207667_11880517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii561Open in IMG/M
3300025961|Ga0207712_10217017All Organisms → cellular organisms → Bacteria → Terrabacteria group1527Open in IMG/M
3300025981|Ga0207640_10126232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1842Open in IMG/M
3300026035|Ga0207703_10479288All Organisms → cellular organisms → Bacteria → Terrabacteria group1166Open in IMG/M
3300026041|Ga0207639_10431129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus1194Open in IMG/M
3300026067|Ga0207678_11046542All Organisms → cellular organisms → Bacteria → Terrabacteria group723Open in IMG/M
3300026121|Ga0207683_10671511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus960Open in IMG/M
3300026312|Ga0209153_1298993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium515Open in IMG/M
3300026508|Ga0257161_1068535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Tenggerimyces → Tenggerimyces flavus726Open in IMG/M
3300026524|Ga0209690_1210814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300026527|Ga0209059_1243441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium603Open in IMG/M
3300026551|Ga0209648_10175630All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300026911|Ga0209620_1028823Not Available509Open in IMG/M
3300027034|Ga0209730_1001862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_111538Open in IMG/M
3300027297|Ga0208241_1000650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3679Open in IMG/M
3300027696|Ga0208696_1286413All Organisms → cellular organisms → Bacteria → Terrabacteria group506Open in IMG/M
3300027725|Ga0209178_1023371All Organisms → cellular organisms → Bacteria → Terrabacteria group1927Open in IMG/M
3300027765|Ga0209073_10152557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300027775|Ga0209177_10273947Not Available633Open in IMG/M
3300027821|Ga0209811_10152024All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300027875|Ga0209283_10358973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11955Open in IMG/M
3300027903|Ga0209488_10207949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1474Open in IMG/M
3300028047|Ga0209526_10476708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium817Open in IMG/M
3300030056|Ga0302181_10463877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii538Open in IMG/M
3300030523|Ga0272436_1050253All Organisms → cellular organisms → Bacteria2012Open in IMG/M
3300031233|Ga0302307_10458222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii647Open in IMG/M
3300031234|Ga0302325_10151986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4137Open in IMG/M
3300031452|Ga0272422_1065470All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300031452|Ga0272422_1092471All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300031472|Ga0272437_1167824All Organisms → cellular organisms → Bacteria → Terrabacteria group1245Open in IMG/M
3300031549|Ga0318571_10105218All Organisms → cellular organisms → Bacteria → Terrabacteria group929Open in IMG/M
3300031564|Ga0318573_10375790Not Available763Open in IMG/M
3300031573|Ga0310915_10399302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria976Open in IMG/M
3300031681|Ga0318572_10006725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5199Open in IMG/M
3300031681|Ga0318572_10033140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2701Open in IMG/M
3300031681|Ga0318572_10747613Not Available582Open in IMG/M
3300031708|Ga0310686_100808673All Organisms → cellular organisms → Bacteria → Terrabacteria group1164Open in IMG/M
3300031708|Ga0310686_113421042All Organisms → cellular organisms → Bacteria → Terrabacteria group670Open in IMG/M
3300031715|Ga0307476_10709505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11745Open in IMG/M
3300031718|Ga0307474_10042107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3368Open in IMG/M
3300031720|Ga0307469_10103698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2006Open in IMG/M
3300031720|Ga0307469_12437019Not Available511Open in IMG/M
3300031723|Ga0318493_10640418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300031724|Ga0318500_10335428All Organisms → cellular organisms → Bacteria → Terrabacteria group745Open in IMG/M
3300031736|Ga0318501_10274008All Organisms → cellular organisms → Bacteria → Terrabacteria group897Open in IMG/M
3300031770|Ga0318521_10253705All Organisms → cellular organisms → Bacteria → Terrabacteria group1027Open in IMG/M
3300031770|Ga0318521_11000599All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031779|Ga0318566_10653765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11510Open in IMG/M
3300031781|Ga0318547_10491230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia758Open in IMG/M
3300031794|Ga0318503_10227103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300031795|Ga0318557_10588496Not Available511Open in IMG/M
3300031799|Ga0318565_10071302Not Available1640Open in IMG/M
3300031799|Ga0318565_10602452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11528Open in IMG/M
3300031805|Ga0318497_10421163Not Available747Open in IMG/M
3300031819|Ga0318568_10102405Not Available1716Open in IMG/M
3300031819|Ga0318568_10804497All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M
3300031821|Ga0318567_10124960Not Available1409Open in IMG/M
3300031823|Ga0307478_10920743All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300031833|Ga0310917_10034841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3002Open in IMG/M
3300031833|Ga0310917_10212435Not Available1296Open in IMG/M
3300031845|Ga0318511_10216557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jeojiense854Open in IMG/M
3300031894|Ga0318522_10074107Not Available1236Open in IMG/M
3300031901|Ga0307406_11860283All Organisms → cellular organisms → Bacteria → Terrabacteria group536Open in IMG/M
3300031912|Ga0306921_11310190All Organisms → cellular organisms → Bacteria → Terrabacteria group801Open in IMG/M
3300031912|Ga0306921_11578335All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031954|Ga0306926_11679371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11726Open in IMG/M
3300031954|Ga0306926_12618649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300031962|Ga0307479_11802275All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300031981|Ga0318531_10318556All Organisms → cellular organisms → Bacteria → Terrabacteria group703Open in IMG/M
3300032001|Ga0306922_10396991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1477Open in IMG/M
3300032001|Ga0306922_10505287Not Available1288Open in IMG/M
3300032010|Ga0318569_10182876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica970Open in IMG/M
3300032025|Ga0318507_10451135All Organisms → cellular organisms → Bacteria → Terrabacteria group560Open in IMG/M
3300032052|Ga0318506_10079757Not Available1372Open in IMG/M
3300032054|Ga0318570_10566865All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300032060|Ga0318505_10603033Not Available516Open in IMG/M
3300032063|Ga0318504_10033867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2050Open in IMG/M
3300032066|Ga0318514_10394669All Organisms → cellular organisms → Bacteria → Terrabacteria group734Open in IMG/M
3300032068|Ga0318553_10055595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1958Open in IMG/M
3300032068|Ga0318553_10189573Not Available1071Open in IMG/M
3300032074|Ga0308173_11347566All Organisms → cellular organisms → Bacteria → Terrabacteria group669Open in IMG/M
3300032076|Ga0306924_12303516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300032180|Ga0307471_101116536All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300032180|Ga0307471_103256971All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300032205|Ga0307472_102091228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11569Open in IMG/M
3300032261|Ga0306920_101007780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1212Open in IMG/M
3300032261|Ga0306920_101424551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11992Open in IMG/M
3300032261|Ga0306920_103308318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300032898|Ga0335072_10209760All Organisms → cellular organisms → Bacteria2296Open in IMG/M
3300032898|Ga0335072_10329061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1689Open in IMG/M
3300033158|Ga0335077_10584038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1168Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.29%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.10%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.20%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.20%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.20%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock1.20%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.50%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.90%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.90%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.60%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.60%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.60%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.60%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.60%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley0.30%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.30%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.30%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.30%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.30%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.30%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.30%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.30%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.30%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.30%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.30%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.30%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.30%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.30%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.30%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2209111022Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichmentEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012678Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015084Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022561Borup_combined assemblyEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026911Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027034Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030523Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstoneEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031452Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nordEnvironmentalOpen in IMG/M
3300031472Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstoneEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_066147002170459005Grass SoilPRPVAYERRTGQPAPYGAWGVDINCAVIGFIDKAPTANLADPVANSQFPPR
22220441582209111022Grass SoilVNPATGQPAPYGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
ICChiseqgaiiDRAFT_073930713300000033SoilGTGEPAPYGSVGVDINCAVLGFIDKAPKANLADPVAGSQFPPR*
JGI10216J12902_10193126913300000956SoilYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR*
JGI10216J12902_10590186623300000956SoilVDPATGKPAPYGSVGVDINCAVIGFTNKAPTANLADPLPNSQFPPR*
JGI10216J12902_10630564413300000956SoilGPGGAPYGATGTDINCAVIGFIDKAPTENLADPVPNSQFPPR*
JGI10216J12902_11122354113300000956SoilVDPATGQPAPYGSVGVDINCAVIGFTAEPPTANLAQPLPNSQFPPR*
JGI12627J18819_1026715633300001867Forest SoilGSAGVDINCAVIGYTAQAPTANLAPNVPGSQFPPR*
C688J35102_11934069223300002568SoilGGAPYGAAGVDINCAVIGFTSKAPAKNLAAPVPNSQFPPR*
Ga0068993_1005467913300005183Natural And Restored WetlandsPATGEPAPYGSVGVDINCAVIGWTDKPPTANLADPVPNSQFPPR*
Ga0070709_10000935153300005434Corn, Switchgrass And Miscanthus RhizosphereTGQPAPYGASGVDINCAVIGFTLKAPTANLAPPAPHSQFEPR*
Ga0070709_1161871723300005434Corn, Switchgrass And Miscanthus RhizosphereGQPAPYGATGVDINCAVIGFTNKAPTANLANPVPNSQFPPR*
Ga0070714_10174164913300005435Agricultural SoilPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR*
Ga0070710_1004515213300005437Corn, Switchgrass And Miscanthus RhizosphereNPATGQPAPYGASGVDINCAVIGFTLKAPTANLAPPAPHSQFEPR*
Ga0070708_10142266823300005445Corn, Switchgrass And Miscanthus RhizosphereTGPGGAPYGSVGIDINCAVIGFTDEAPTANLVAPVPNSQFPPR*
Ga0070663_10051465223300005455Corn RhizosphereGAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR*
Ga0070706_10097811113300005467Corn, Switchgrass And Miscanthus RhizosphereGQPAPYGADGVNINCAVIGYTATAPTANLAPPAPNSQFPPR*
Ga0070706_10129468213300005467Corn, Switchgrass And Miscanthus RhizosphereGQPAAYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR*
Ga0070707_10058511113300005468Corn, Switchgrass And Miscanthus RhizosphereGQPAPYGADGVNINCAVIGYTAQAPTANLAPPAPLSQFPPR*
Ga0070707_10108744823300005468Corn, Switchgrass And Miscanthus RhizosphereTGQPAAYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR*
Ga0070707_10174467813300005468Corn, Switchgrass And Miscanthus RhizosphereATGQPAPYGATGVDINCAVIGFTDKAPTANLANPLPNSQFPPR*
Ga0070698_10057792733300005471Corn, Switchgrass And Miscanthus RhizosphereGQPAPYGASGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR*
Ga0070698_10173732633300005471Corn, Switchgrass And Miscanthus RhizosphereQPAPYGAAGVDINCAVLGFTAKAPTANLAPPAPNSQFPPR*
Ga0070698_10196825013300005471Corn, Switchgrass And Miscanthus RhizosphereTGPGGAPYGSVGIDINCAVIGFTAKAPTANLVTPAPNSQFPPR*
Ga0070699_10184841823300005518Corn, Switchgrass And Miscanthus RhizosphereQPAPYGASGVDINCAVIGFTAHAPTANLAPPAPHSQFEPR*
Ga0073909_1067220313300005526Surface SoilATGQPAPYGASGVDINCAVIGFTAKAPTANLATPLPNSQFPPR*
Ga0070735_1036899823300005534Surface SoilPATGQPQLYGSVGVDINCAVIGFTATAPTTPGPPNLPGSQFPPR*
Ga0070684_10099363123300005535Corn RhizosphereGQPAPYGSVGVDINCAVIGFIDKAPTANLEDPVPDSQFPPR*
Ga0066697_1063672123300005540SoilTGNPAPYGSVGVDINCAVIGFIDKAPAANLADPVPNSQFPPR*
Ga0070732_1057316433300005542Surface SoilATGVDINCAVIGFTDKPPTQNLANPLPNSQFPPR*
Ga0066707_1102255913300005556SoilATGEPAPYGSVGVDINCAVIGFTADAPTANLAEPVANSQFPPL*
Ga0066704_1038278213300005557SoilVDPATGKPAPYGSVGVDINCAVIGFTDKAPTANLADPVPNSQFPPR*
Ga0066704_1067924223300005557SoilITGPGGAPYGSVGIDINCAVIGFTNDAPTANLAAPVPNSQFPPR*
Ga0066704_1088197513300005557SoilGTVGIDINCAVIGFTANAPTANLVAPVPNSQFPPR*
Ga0066700_1099176733300005559SoilPYGSVGIDINCAVIGFIDEAPTANLVEPAPNSQFPPR*
Ga0066670_1033187813300005560SoilGSVGVDINCAVIGFIDKAPATNLADPVPNSQFPPR*
Ga0066699_1124757323300005561SoilPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR*
Ga0066702_1072977013300005575SoilEPYGSAGVDINCAVIAYTADAPTANLAAPVPGSQFPPR*
Ga0066708_1031787713300005576SoilPAPYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR*
Ga0068852_10189395523300005616Corn RhizosphereYGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR*
Ga0066903_10136265533300005764Tropical Forest SoilSVGVDINCAVIGFTDKAPKANLADPAPNSQFPPR*
Ga0066903_10504964313300005764Tropical Forest SoilYGSVGVDINCAVIGFIDKAPTANLADPAPNSQFPPR*
Ga0066903_10602957023300005764Tropical Forest SoilPAPYGSVGVDINCAVIGFTDKAPTANLADPAPGSQFPPR*
Ga0068860_10218433413300005843Switchgrass RhizosphereAPYGSVGVDINCAVIGFTAAAPTANLAPPAANSQFPPR*
Ga0070717_1018453133300006028Corn, Switchgrass And Miscanthus RhizosphereGTVGIDINCAVIGFTDLAPTANLVTPAPNSQFPPR*
Ga0070717_1086584323300006028Corn, Switchgrass And Miscanthus RhizosphereNPATGQPAPYGASGVDINCAVIGFTLKAPTANLAPPAPNSPFEPR*
Ga0070717_1121579713300006028Corn, Switchgrass And Miscanthus RhizospherePAPYGSAGVDINCAVIGFTAAAPTANLAPPAPDSQFPPR*
Ga0070717_1164516723300006028Corn, Switchgrass And Miscanthus RhizosphereSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR*
Ga0066696_1025720513300006032SoilAAPYGASGVDINCAVIGFTDQAPTANLATPVPNSQFPPR*
Ga0066652_10206572513300006046SoilSVGVDINCAVIGFTAKAPTANLADPVPNSQFPPR*
Ga0070716_10002950813300006173Corn, Switchgrass And Miscanthus RhizosphereNPATGQPAAYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR*
Ga0070712_10029623323300006175Corn, Switchgrass And Miscanthus RhizosphereAAGVDINCAVIGFTAMAPTANLATPVPNSQFPPR*
Ga0070712_10064753923300006175Corn, Switchgrass And Miscanthus RhizosphereYGAAGVDINCAVLGFTAHAPTANLAPPAPHSQFEPR*
Ga0070712_10127073513300006175Corn, Switchgrass And Miscanthus RhizosphereAPYGAAGVDINCAVIGFTADAPTANLAEPVANSQFPPL*
Ga0068871_10075530633300006358Miscanthus RhizospherePYGSVGVDINCAVIGFTDKAPTANLADPVPGSQFPPR*
Ga0079222_1026657233300006755Agricultural SoilAQYGATAVDINCAVIGFTNKAPTANLANPVPNSQFPPR*
Ga0066665_1146306513300006796SoilPYGASGVDINCAVIGFTDQAPTANLATPVPNSQFPPR*
Ga0066660_1158040123300006800SoilAPYGAAGVDINCAVLGFTNQAPTENLAEPAPNSQFPPR*
Ga0079221_1088542213300006804Agricultural SoilPAPYGSAGVDINCAVIGFTAAAPTANLAPPAANSQFPPR*
Ga0079220_1012579913300006806Agricultural SoilGSVGIDINCAVIGFTAKAPTANLVTPAPNSQFPPR*
Ga0075428_10036714413300006844Populus RhizospherePATGKPAPYGSVGVDINCAVIGFTAEPPTANLAQPLPNSQFPPR*
Ga0075433_1010621513300006852Populus RhizospherePYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR*
Ga0075433_1118899313300006852Populus RhizosphereATGVDINCAVIGFTAKAPTANLANPLPNSQFPPR*
Ga0075425_10034635843300006854Populus RhizosphereAAGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR*
Ga0075425_10210053513300006854Populus RhizospherePATGQPAPYGSAGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR*
Ga0075434_10045665543300006871Populus RhizosphereAPYGATGVDINCAVIGFTDKAPTANLAQPLPNSQFPPR*
Ga0075426_1016659113300006903Populus RhizosphereNPATGQPAAYGATGVDINCAVIGFTHEAPTANLANPLPNSQFPPR*
Ga0075426_1066775113300006903Populus RhizosphereGPGGAPYGSVGIDINCAVIGFTAKAPTENLVTPAPNSQFPPR*
Ga0075426_1124503223300006903Populus RhizosphereVNPATGQPAPYGSAGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR*
Ga0075426_1125358913300006903Populus RhizospherePATGQPAPYGATGVDINCAVIGFTDKAPTANLAQPLPNSQFPPR*
Ga0075426_1134086523300006903Populus RhizosphereGATGVDINCAVIGFTAKAPTANLADPLPNSQFPPR*
Ga0075424_10025675113300006904Populus RhizosphereAAGVDINCAVIGFTAHAPTANLAAPAANSQFPPR*
Ga0075424_10158002913300006904Populus RhizosphereATGVDINCAVIGFTDKAPTANLANPLPNSQFPPR*
Ga0075424_10280464913300006904Populus RhizosphereGQPAPYGATGVDINCAVIGFTDKAPTANLANPLPNSQFPPR*
Ga0079219_1008102013300006954Agricultural SoilYGSAGVDINCAVIGFTAAAPTANLAPPAANSQFPPR*
Ga0066710_10046270313300009012Grasslands SoilGPGGAPYGAAGVDINCAVIGFIDKAPTANLADPVPNSQFPPR
Ga0099829_1076755113300009038Vadose Zone SoilGGAPYGAAGVDINCAVIGFTDQAPTANLATPVPNSQFPPR*
Ga0099829_1083787613300009038Vadose Zone SoilPYGSAGVDINCAVIGFTASAPTANLAPPAPHSQFPPR*
Ga0099830_1083492523300009088Vadose Zone SoilLITAPAGAPYGSVRIATTFAVLAFTTLAPTANLVAPVPNSQFPPR*
Ga0099827_1029690313300009090Vadose Zone SoilSVGIDINCAVIGFTDEPPTANLVAPVPNSQFPPR*
Ga0099827_1073197113300009090Vadose Zone SoilNPATGQPAPYGSVGVDINCAVIGFTASAPTANLAPPAPNSQFPPR*
Ga0099827_1131643323300009090Vadose Zone SoilGAAGVDINCAVIGFTAMAPTVNLATPVPNSQFPPR*
Ga0075418_1180365413300009100Populus RhizosphereDPATGKPAPYGSVGVDINCAVIGFTAEPPTANLAQPLPNSQFPPR*
Ga0066709_10134569723300009137Grasslands SoilGAWGVDINCAVIGFIDKAPTANLADPAPNSQFPPR*
Ga0099792_1014144413300009143Vadose Zone SoilPAPYGSVGVDINCAVIGFIDKAPTANLADPIPNSQFPPR*
Ga0099792_1082310213300009143Vadose Zone SoilNPATGQPAPYGSAGVDINCAVIAFTAQAPTANLAPPAPHSQFPPR*
Ga0114129_1011310113300009147Populus RhizosphereAPYGAVGVDINCAVIGFIDKAPTANLADPAPNSQFPPR*
Ga0114129_1165729513300009147Populus RhizosphereAPYGATGVDINCAVIGFTNKAPTANLANPIPNSQFPPR*
Ga0114129_1172749313300009147Populus RhizosphereGATGVDINCAVIGFTDKAPTANLANPSPNSQFPPR*
Ga0075423_1053966013300009162Populus RhizosphereQPAPYGAAGVDINCAVIGFTAHAPTANLAPPAANSQFPPR*
Ga0075423_1321259613300009162Populus RhizosphereGATGVDINCAVIGFTDKAPTANLANPLPNSQFPPR*
Ga0105241_1092733513300009174Corn RhizosphereITGPGGAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR*
Ga0105241_1102580313300009174Corn RhizosphereYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR*
Ga0105248_1092871513300009177Switchgrass RhizospherePYGSVGVDINCAVIGFTAQARTANLAPPAPHSQFPPR*
Ga0116218_116137613300009522Peatlands SoilQPAPYGSVGVDINCAVIGYTAAAPTANLAPPAANSQFPPR*
Ga0116216_1014994013300009698Peatlands SoilDPATGQPEPYGSVGVDINCAVIGYTASAPTANLASPAPNSQFPPR*
Ga0116216_1077470923300009698Peatlands SoilATGQPAPYGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR*
Ga0126374_1134342913300009792Tropical Forest SoilYGAVGVDINCAVIGFTSQAPTANLATPAPNSQFPPR*
Ga0105089_102538813300009809Groundwater SandKPAPYGSVGVDMDCAVIGFTNKAPTANLADPIPNSQFPPR*
Ga0105076_110281613300009816Groundwater SandVNPATGKPAPYGSVGVDINCAVIGFTNKAPTANLADPIPNSQFPPR*
Ga0126308_1125253513300010040Serpentine SoilPYGATGVDINCAVIGFLAKPPTANLEAPVRHSQFPPR*
Ga0126380_1161170813300010043Tropical Forest SoilQPAPYGSVGVDIDCAVIGFIDQPPTANLAPPAAHSQFPPR*
Ga0126311_1044714823300010045Serpentine SoilVDPATGQPAPYGSVGVDINCAVIGFTRRAPKANLADPVPGSQFPPR*
Ga0126384_1145288513300010046Tropical Forest SoilYGSVGVDINCAVIGFIDKAPTANLADPVPNSQFPPR*
Ga0126373_1212285813300010048Tropical Forest SoilNPATGQPAPYGSVGVDINCAVIGFTAKAPTANLAPPAPNSQFPPR*
Ga0126373_1276565323300010048Tropical Forest SoilPQLYGSVGVDINCAVIGYTAKAPTTPGPPNLPGSQFPPR*
Ga0126373_1278155413300010048Tropical Forest SoilGQPAPYGSVGVDINCAVLGFTAHAPTANLASPAPHSQFPPR*
Ga0126372_1144597713300010360Tropical Forest SoilTGQPAPYGAVGVDINCAVIGFTNQAPTANLATPAPNSQFPPR*
Ga0126372_1306711223300010360Tropical Forest SoilSVGVDINCAVIAFTNKAPTANLAAPVPNSQFPPR*
Ga0126378_1211196513300010361Tropical Forest SoilYGSVGVDINCAVIGYTAQAPTANLASPVPNSQFPPR*
Ga0134125_1038873413300010371Terrestrial SoilTGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR*
Ga0134125_1155113313300010371Terrestrial SoilYGSVGVDINCAVIGFTAQAPTANLAPPAPNSQFPPR*
Ga0134128_1105036133300010373Terrestrial SoilSVGVDINCAVIGYTAHAPTANLAAPVPGSQFPPR*
Ga0105239_1124758413300010375Corn RhizosphereGPGGAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR*
Ga0105239_1250906123300010375Corn RhizosphereATGKPAPYGSVGVDINCAVIGFTEKAPKANLADPAPNSQFPPR*
Ga0126381_10257459713300010376Tropical Forest SoilQPEPYGSVGVDINCAVIGFTANAPTANLAQPAPGSQFPPR*
Ga0136449_10121493913300010379Peatlands SoilPYGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR*
Ga0134126_1217398223300010396Terrestrial SoilYGATGVDINCAVIGFTDKAPTANLADPLPNSQFPPR*
Ga0126383_1359244323300010398Tropical Forest SoilVDPATGQPAPYGAVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR*
Ga0134121_1012853833300010401Terrestrial SoilGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR*
Ga0126361_1025068013300010876Boreal Forest SoilVNPATGQPEPYGSVGVDINCAVIGFTASAPTANLAQPVPGSQFPPR*
Ga0137391_1016162843300011270Vadose Zone SoilGPGGAPYGSVGIDINCAVIGFIDEPPTANLVAPVPNSQFPPR*
Ga0136623_1004040533300012045Polar Desert SandTGRSVGVDINCAVIGFTADPPTADLVDPAPESQFPPR*
Ga0137389_1183382613300012096Vadose Zone SoilPYGSVGIDINCAVIGFTNDAPTANLVAPVPNSQFPPR*
Ga0137383_1012840513300012199Vadose Zone SoilQPEPYGSAGVDINCAVIGFTLKAPTANLATPAMHSQFPPR*
Ga0137383_1026801113300012199Vadose Zone SoilYGAAGVDINCAVIGFTDTAPTANLATPVPNSQFPPR*
Ga0137383_1070168613300012199Vadose Zone SoilAPYGSVGVDINCAVIGFTAKPPTANLADPLPNSQFPPR*
Ga0137383_1103763713300012199Vadose Zone SoilPATGQPAAYGASGVNINCAVIGFIDKAPTANLAKPLPNSQFPPR*
Ga0137382_1003408413300012200Vadose Zone SoilPYGSVGVDINCAVIGFIDKAPTANLADPVPNSQFPPR*
Ga0137382_1047470023300012200Vadose Zone SoilYGAAGVDINCAVIGFTAAAPTANLEDPVANSQFPPL*
Ga0137382_1130340413300012200Vadose Zone SoilQPAPYGSVGVDINCAVIGFTDKAPTANLADPVPNSQFPPR*
Ga0137365_1002568093300012201Vadose Zone SoilPATGQPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPNSQFPPR*
Ga0137365_1016492233300012201Vadose Zone SoilVNPATGQPAPYGSVGVDINCAVIGFTAKAPTANLADPVPNSQFPPR*
Ga0137365_1044862023300012201Vadose Zone SoilVNPATGQPAPYGSVGVDINCAVIGFTAKAPTANLAPPAPHSQFPPR*
Ga0137363_1173644423300012202Vadose Zone SoilPAPYGASGVDINCAVIGFTDKAPTANLAEPVPNSQFPPR*
Ga0137399_1049708123300012203Vadose Zone SoilLTGLGGAPYGRVGIDINCAVIGFTAIAPTANLVTPAPNSQFPPR*
Ga0137374_1034434813300012204Vadose Zone SoilVDPATGKPAPYGAAGVDINCAVIGFTDKAPTANLAAPMPNSQFPPR*
Ga0137380_1160956413300012206Vadose Zone SoilYGSAGVDINCAVIGFTANAPTANLATPAPHSQFPPR*
Ga0137381_1091419123300012207Vadose Zone SoilGKPAPYGAQGVDINCAVIGFTDKAPTANLATPVPNSQFPPR*
Ga0137379_1150827433300012209Vadose Zone SoilTGPGGAPYGTVGIDINCAVIGFTAHAPSANLVTPAPNSQFPPR*
Ga0137379_1151548313300012209Vadose Zone SoilPATGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSPFPPR*
Ga0137378_1019566043300012210Vadose Zone SoilPYGSAGVDINCAVIGFTLKAPTANLATPALHSQFPPR*
Ga0137378_1096120213300012210Vadose Zone SoilQPTPYGSVGVDINCAVIGFTAHAPTANLAPPAPNSQFPPR*
Ga0137377_1016177363300012211Vadose Zone SoilATGQPAPYGAAGVDINCAVIGFTATAPTANLAPPAPNSQFPPR*
Ga0137377_1034571623300012211Vadose Zone SoilLVLLVVVVRPGQYGAAGVDINCAVIGFTANAPTANLEEPVANSQFPPL*
Ga0137377_1126788513300012211Vadose Zone SoilATGQPAPYGAAGVDINCAVIGFTDKAPTANLADPVPNSQFPPR*
Ga0137377_1127091513300012211Vadose Zone SoilYGATGVDINCAVIGFIDKAPTANLADPLPNSQFPPR*
Ga0150985_11792869523300012212Avena Fatua RhizosphereALPICSVGVDINCAVIGFLDKAPTANLAAPVPNSQSPPL*
Ga0137372_1066198213300012350Vadose Zone SoilPYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR*
Ga0137386_1006074713300012351Vadose Zone SoilTGQPAPYGSVGVDINCAVIGFTAKPPTANLAEPLPNSQFPPR*
Ga0137386_1028339233300012351Vadose Zone SoilYGSAGVDINCAVIGFTLKAPTANLATPALHSQFPPR*
Ga0137371_1015152813300012356Vadose Zone SoilAPYGSVGVDINCAVIGFTASAPTANLAPPAANSQFPPR*
Ga0137384_1070507123300012357Vadose Zone SoilSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR*
Ga0137368_1008267083300012358Vadose Zone SoilPYGSVGVDINCAVIGFTAKAPTANLADPVPNSQFPPR*
Ga0137368_1022210613300012358Vadose Zone SoilNPATGQPAPYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR*
Ga0137375_1136389923300012360Vadose Zone SoilYGSVGVDINCAVIGFTAKAPTANLADPVANSQFPPR*
Ga0137361_1042224413300012362Vadose Zone SoilPAPYGSVGVDINCAVIGFIDKAPTANLDDPVPNSQFPPR*
Ga0137361_1043492133300012362Vadose Zone SoilYGATGVDINCAVIGFIDKAPTANLATPAPNSQFPPR*
Ga0137361_1112572023300012362Vadose Zone SoilGAPYGAVGIDINCAVIGFTEKAPTANLVAPAPNSQFPPR*
Ga0137361_1146164523300012362Vadose Zone SoilGAPYGTVGIDINCAVIGFPANAPSANLVTPAPNSQFPPR*
Ga0137390_1124421623300012363Vadose Zone SoilYGSVGVDINCAVIGFTASAPTANLAPPAPNSQFPPR*
Ga0137373_1094163113300012532Vadose Zone SoilAPYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR*
Ga0136615_1048575713300012678Polar Desert SandMPYGASGVSINGAVIGFTDGPPTANPDPAPNSQFPPR*
Ga0157300_111574013300012884SoilIDPATGKPAPYGSVGVDINCAVIGFTDKAPTTNLAEPVPGSQFPPR*
Ga0157302_1044592113300012915SoilTGKPAPYGSVGVDINCAVIGFTDKAPTANLADPVPGSQFPPR*
Ga0137416_1055947013300012927Vadose Zone SoilGAPYGSVGIDINCAVIGFTSDAPTANLVAPVPNSQFPPR*
Ga0137407_1014861913300012930Vadose Zone SoilKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR*
Ga0137407_1068658323300012930Vadose Zone SoilSCGSAGVDTNCALTGFTASAPTANPATPAPHSQFPPR*
Ga0164300_1117264523300012951SoilQPAPYGAAGVDINCAVIGFTAQAPTANLAPPAPLSQFPPR*
Ga0164298_1011838213300012955SoilGSVGVDINCAVIGYTAHAPTANLAAPVPGSQFPPR*
Ga0134110_1039876323300012975Grasslands SoilATGKPAPYGATGVDINCAVIGFVDKAPTANLAEPVANSQFPPR*
Ga0134076_1019761613300012976Grasslands SoilNPATGEPAPYGASGVDINCAVIGFTDKAPTANLADPVPNSQFPPR*
Ga0164309_1153312823300012984SoilDLITGPGGAPYGSAGVDINCAVIGFIDKAPTANLAEPVPNSQFPPR*
Ga0164306_1193725923300012988SoilAPYGATGVDINCAVIGYTAQAPTANLANPLPNSQFPPR*
Ga0157369_1163342013300013105Corn RhizosphereDPATGKPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPHSQFPPR*
Ga0157374_1049208433300013296Miscanthus RhizosphereGSVGVDINCAVIGFTAKPPTANLAAPVAGSQFPPR*
Ga0163162_1105040913300013306Switchgrass RhizosphereKPAPYGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR*
Ga0157372_1257654613300013307Corn RhizospherePATGKPAPYGSVGVDINCAVIGFTDKAPTTNLAEPVPGSQFPPR*
Ga0075323_108765513300014301Natural And Restored WetlandsPAPYGSVGVDINCAVIGFTAKAPTANLAEPAPNSQFPPR*
Ga0182008_1012487213300014497RhizosphereAPYGADGVDINCAVIGYINKAPTANLADPVANSQFPPR*
Ga0157377_1103958413300014745Miscanthus RhizosphereDPATGQPAPYGSVGVDINCAVIGYTAHAPTANLAAPVPGSQFPPR*
Ga0167654_105636613300015084Glacier Forefield SoilGAAGVNINCAVIGFTAKAPTANLATPVPNSQFPPR*
Ga0137403_1043504513300015264Vadose Zone SoilTGQPAPYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR*
Ga0132256_10089048133300015372Arabidopsis RhizosphereYGSVGVDINCAVIGFTEKAPKANLADPAPNSQFPPR*
Ga0182036_1130847923300016270SoilPYGSVGVDINCAVIGYTNKAPTANLAPPAPNSQFPPR
Ga0182034_1004973113300016371SoilPYGSVGVDINCAVIGYTAKAPTANLAPPAPNSQFPPR
Ga0187806_109055233300017928Freshwater SedimentGQPEPYGSVGVDINCAVIGYTAGAPTANLASPAPNSQFPPR
Ga0187821_1034454423300017936Freshwater SedimentYGSVGVDINCAVIGWSGSKPPTANLAPPAPGSQFPPR
Ga0187809_1033097213300017937Freshwater SedimentTGQPQLYGSVGVDINCAVIGFTAQAPTANLAPNLPGSQFPPR
Ga0187853_1033978233300017940PeatlandPALYGSVGVDINCAVIGYTATAPTAALQPSAPLSQFPPR
Ga0187808_1029984613300017942Freshwater SedimentQPQLYGSVGVDINCAVIGYTATAPLTPGPPNLPGSQFPPR
Ga0187780_1103621623300017973Tropical PeatlandGSVGVDINCAVIGYTATAPTAALEPSAPGSQFPPR
Ga0187777_1064814813300017974Tropical PeatlandPYGSVGVDINCAVIGYTATAPTAALEPSAPGSQFPPR
Ga0187886_129341423300018018PeatlandALYGSVGVDINCAVIGYTAKAPTAALQPSLPLSQFPPK
Ga0187857_1022875533300018026PeatlandGQPQLYGSVGVDINCAVIGYTATAPTAALQPPAPLSQFPPR
Ga0187788_1053666923300018032Tropical PeatlandGVDPATGQPAPYGSVGVDINCAVIGFINQAPAANLAAPAPNSPFPPR
Ga0187855_1074630223300018038PeatlandATGQPQLYGSVGVDINCAVIGYSAHTPTANLAPNLPGSQFPPR
Ga0066667_1010866443300018433Grasslands SoilDPATGNPAPYGATGVDINCAVIGFTDKAPTANLADPVPNSQFPPR
Ga0066667_1100933533300018433Grasslands SoilGVDPATGQPARYGAGVDINCAVIGFIDKPPTKNLADPVPDSQFPPR
Ga0193707_120359513300019881SoilPATGQPAPYGSVGVDINCAVIGFTKKAPTANLADPAPNSQFPPR
Ga0193729_103924813300019887SoilTPYGSVGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR
Ga0193728_100049513300019890SoilPAPYGSIGVDINCAVIGFTASAPTANLAPPAANSQFPPR
Ga0210407_1045926113300020579SoilATGQPAPYGAQGVDINCAVIGYTAQAPTANLAPPAPLSQFPPR
Ga0210403_1113862423300020580SoilDPATGKPAPYGAAGVDINCAVLGFTAHAPTANLAPPAPHSQFPPR
Ga0210404_1000788143300021088SoilNPATGQPAPYGSVGVDINCAVIGYTAQAPTANLAPPAPTSQFPPR
Ga0210400_1034669733300021170SoilGQPAPYGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR
Ga0210400_1161978013300021170SoilPYGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR
Ga0210405_1111096813300021171SoilTGKPAPYGAAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
Ga0213882_1005904133300021362Exposed RockPAPYGAVGVDINCAVIGYTADAPTANLAAPAPHSQFPPR
Ga0193699_1021393223300021363SoilVDPATGQPAPYGATGVDINCAVIGFTDKAPTANLANPLSNSQFPPR
Ga0213874_1027932413300021377Plant RootsTGQPAPYGAVGVDINCAVIGYTDQAPTANLATPAPNSQFPPR
Ga0213875_1010915233300021388Plant RootsGSVGVDINCAVIGYTAAAPTANLAPPAPGSQFPPR
Ga0210393_1125771213300021401SoilATGQPEPYGSVGVDINCAVIGYTASAPTANLAPNIPGSQFPPR
Ga0210383_1019619643300021407SoilGSVGVDINCAVIGYTASAPTANLAPNIPGSQFPPR
Ga0210383_1092931913300021407SoilGVNPATGKPAPYGAAGVDINCAVLGFTAHAPTANLAPPAPHSQFPPR
Ga0210384_1019276023300021432SoilPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
Ga0210402_1055023913300021478SoilPTPYGSVGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR
Ga0210410_1018861013300021479SoilPYGAQGVDINCAVIGYTAQAPTANLAPPAPLSQFPPR
Ga0222621_111961223300021510Groundwater SedimentPAPYGASGVDINCAVIGFTDKAPTANLADPVPNSQFPPR
Ga0210409_1008749113300021559SoilAPYGSAGVDINCAVIGFTAAAPTANLAPPAPDSQFPPR
Ga0210409_1014031443300021559SoilTGQPEPYGSVGVDINCAVIGYTATAPTANLASPAPNSQFPPR
Ga0212090_1028534813300022561Glacier ValleyYGSVGVDINCAVIGYTNTAPTAALATNLPRSQFPPR
Ga0137417_138275113300024330Vadose Zone SoilSVGVDINCAVIGWTGDQPPTANLEAPAPNSQFPPR
Ga0207656_1035446513300025321Corn RhizosphereYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
Ga0210138_114133923300025580Natural And Restored WetlandsPAPYGSVGVDINCAVIGWTDKPPTANLADPVPNSQFPPR
Ga0207692_1058501723300025898Corn, Switchgrass And Miscanthus RhizosphereGQPAPYGASGVDINCAVIGFTLKAPTANLAPPAPHSQFEPR
Ga0207692_1084739923300025898Corn, Switchgrass And Miscanthus RhizosphereYGSVGVDINCAVIGFTAHAPTANLAPPAPHSQFPPR
Ga0207699_1074684433300025906Corn, Switchgrass And Miscanthus RhizosphereGQPAPYGSVGVDINCAVIGYTAHAPTANLAAPVPGSQFPPR
Ga0207699_1133245723300025906Corn, Switchgrass And Miscanthus RhizosphereGKPAPYGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
Ga0207699_1145805423300025906Corn, Switchgrass And Miscanthus RhizosphereYGSVGVDINCAVIGYTAAAPTANLAPPAPNSQFPPR
Ga0207654_1069778513300025911Corn RhizosphereDPSTGKPAPYGSVGVDINCAVIGFTAKPPTANLAQPVPGSQFPPR
Ga0207693_1017531033300025915Corn, Switchgrass And Miscanthus RhizosphereQPAPYGADGVNINCAVIGYTAQAPTANLAPPAPNSQFPPR
Ga0207693_1027097813300025915Corn, Switchgrass And Miscanthus RhizosphereNPATGQPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPHSQFPPR
Ga0207693_1065164623300025915Corn, Switchgrass And Miscanthus RhizosphereQPAPYGADGVNINCAVIGYTAQAPTANLAPPAPLSQFPPR
Ga0207693_1103174723300025915Corn, Switchgrass And Miscanthus RhizosphereATGQPAPYGAAGVDINCAVIGFTADAPTANLAEPVANSQFPPL
Ga0207646_1016927413300025922Corn, Switchgrass And Miscanthus RhizospherePYGASGVDINCAVIGFTDKAPTANLADPVPNSQFPPR
Ga0207700_1049699513300025928Corn, Switchgrass And Miscanthus RhizosphereAPYGSVGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
Ga0207700_1158852813300025928Corn, Switchgrass And Miscanthus RhizosphereGQPAPYGSVGVDINCAVIGFTDKAPTANLADPAPNSQFPPR
Ga0207700_1165006423300025928Corn, Switchgrass And Miscanthus RhizospherePGGAPYGTVGIDINCAVIGFTADAPTANLVTPAPNSQFPPR
Ga0207664_1022594013300025929Agricultural SoilQPAAYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR
Ga0207664_1028996243300025929Agricultural SoilGPGGAPYGTVGIDINCAVLGFTNLPPTTNLVAPVPNSQFPPR
Ga0207665_1002262813300025939Corn, Switchgrass And Miscanthus RhizosphereQPAPYGASGVDINCAVIGFTLKAPTANLAPPAPHSQFEPR
Ga0207665_1029854023300025939Corn, Switchgrass And Miscanthus RhizosphereNPATGQPAPYGASGVDINCAVIGFTAKAPTANLAAPVPNSQFPPR
Ga0207667_1188051723300025949Corn RhizosphereNPATGQPAPYGSVGVDINCAVIGYIAQAPTANLAPPAPNSQFPPR
Ga0207712_1021701743300025961Switchgrass RhizosphereATGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
Ga0207640_1012623213300025981Corn RhizospherePAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
Ga0207703_1047928823300026035Switchgrass RhizosphereITGPGGAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR
Ga0207639_1043112913300026041Corn RhizospherePATGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
Ga0207678_1104654213300026067Corn RhizosphereYGAAGVDINCAVIGFSDKAPTANLAQPVPGSQFPPR
Ga0207683_1067151123300026121Miscanthus RhizosphereTGKPAPYGSAGVDINCAVIGFTAAAPTANLAPPAPNSQFPPR
Ga0209153_129899313300026312SoilGGAPYGASTVDINCAVIGFTDQAPTANLATPVPNSQFPPR
Ga0257161_106853513300026508SoilITGPGGAPYGSVGIDINCAVIGFTNEAPTANLVAPVPNSQFPPR
Ga0209690_121081423300026524SoilGQPAPYGAAGVDINCAVIGFTAKAPTANLADPVPNSQFPPR
Ga0209059_124344113300026527SoilGPGGAPYGTVGIDINCAVIGFTADAPTANLVAPVPNSQFPPR
Ga0209648_1017563023300026551Grasslands SoilGPYGSVGIDINCAVIGFTNLAPTANLVAPVPNSQFPPR
Ga0209620_102882313300026911Forest SoilPEPYGAAGVDINCAVIGYTAQAPTANLAPNVPGSQFPPR
Ga0209730_100186233300027034Forest SoilTGEPAPYGADGVDINCAVLGFTNHAPTENLEPPVPNSQFPPR
Ga0208241_100065063300027297Forest SoilVDPATGQPEPYGSVGVDINCAVIGYTASAPTANLAPNIPGSQFPPR
Ga0208696_128641323300027696Peatlands SoilQPEPYGSVGVDINCAVIGYTASAPTANLASPAPNSQFPPR
Ga0209178_102337143300027725Agricultural SoilGAPYGSVGIDINCAVIGFTAKAPTANLVAPAPNSQFPPR
Ga0209073_1015255733300027765Agricultural SoilATGKPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPNSQFPPR
Ga0209177_1027394723300027775Agricultural SoilPATGKPAPYGSVGVDINCAVIGFTAQAPTANLAQPVPGSQFPPR
Ga0209811_1015202433300027821Surface SoilATGQPAPYGASGVDINCAVIGFTDKAPTANLADPVPNSQFPPR
Ga0209283_1035897323300027875Vadose Zone SoilTGQPAPYGSVGVDINCAVIGFTAQAPTANLAPPAPHSQFPPR
Ga0209488_1020794913300027903Vadose Zone SoilQPAPYGAAGVDINCAVIGYTANAPTANLAPPAPGSQFPPR
Ga0209526_1047670813300028047Forest SoilYGAQGVDINCAVIGFTAMAPTANLATPVPNSQFPPR
Ga0302181_1046387723300030056PalsaTGQPQLYGSVGVDINCAVIGYTAKAPTNALQPSAPGSQFEPR
Ga0272436_105025333300030523RockPKPYGSAGVDINCAVIGFTAQPPTANLAPPAPHSQFPPR
Ga0302307_1045822223300031233PalsaTGQPQLYGSVGVDINCAVIGYTATAPLTPGSPNLPGSQFPPR
Ga0302325_1015198673300031234PalsaGSVGVDINCAVIGYTATAPLTPGPPNLPGSQFPPR
Ga0272422_106547023300031452RockYGSAGVDINCAVIGFTAQPPTANLAPPAPHSQFPPR
Ga0272422_109247113300031452RockPKPYGSAGVDINCAIIGFTAKPPTANLAPPAPHSQFPPR
Ga0272437_116782413300031472RockYGSVGIDINCAVIGYTAQAPTANLAASAPGSQFPPR
Ga0318571_1010521823300031549SoilPYGSVGVDINCAVIGFTDKAPTANLAAPVPNSQFPPR
Ga0318573_1037579023300031564SoilTLQPVPYGSVGVDINCAVLGWSGKKPPTANLAPPAPGSQFPPR
Ga0310915_1039930233300031573SoilPGTGQPQPYGSAGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR
Ga0318572_1000672573300031681SoilVDPGTGQPQPYGSAGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR
Ga0318572_1003314053300031681SoilATGQPEPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR
Ga0318572_1074761313300031681SoilYGSVGVDINCAVIGWSGKKPPTANLAPPAPGSQFPPR
Ga0310686_10080867313300031708SoilTGQPQLYGSVGVDINCAVIGYTATAPQTPGPPNLPGSQFPPR
Ga0310686_11342104213300031708SoilPATGQPEPYGSVGVDINCAVIGYTAQAPTANLAPPAPGSQFPPR
Ga0307476_1070950513300031715Hardwood Forest SoilPATGQPAPYGSAGVDINCAVIGFTAQAPTANLAPPAPLSQFPPR
Ga0307474_1004210753300031718Hardwood Forest SoilATGQPKPYGSAGVDINCAVIGFTAQAPTANLAPPVPGSQFPPR
Ga0307469_1010369813300031720Hardwood Forest SoilAPYGSVGVDSNCAVIGYIAQAPTANLAPPAPNSQFPPR
Ga0307469_1243701913300031720Hardwood Forest SoilPATGQPAPYGASGVDINCAVIGFTAKAPTANLATPLPNSQFPPR
Ga0318493_1064041823300031723SoilSVGVDINCAVIGWSGNKPPTANLAPPAPGSQFPPR
Ga0318500_1033542823300031724SoilPATVQPQPYGSVGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR
Ga0318501_1027400833300031736SoilEPYGSVGVDINCAVIGFTNKAPTANLAPPAPNSQFPPR
Ga0318521_1025370523300031770SoilPQPYGSVGVDINCAVIGYTAKAPTANLAPPAPNSQFPPR
Ga0318521_1100059923300031770SoilAPYGSVGVDINCAVIGFTNKPPTANLADPVANSQFPPR
Ga0318566_1065376513300031779SoilPATGQPAPYGSVGVDINCAVIGYTAQAPTANLAAPVPGSQFPPR
Ga0318547_1049123013300031781SoilNPATGQPQLYGSVGVDINCAVIGYTAKAPTVNLAPNLPGSQFPPR
Ga0318503_1022710323300031794SoilTGQPTPYGSVGVDINCAVIGYTNQAPTANLAAPVPGSQFPPR
Ga0318557_1058849623300031795SoilTLQPVSYGSVGVDINCAVLGWSGKKPPTANLAPPAPGSQFPPR
Ga0318565_1007130213300031799SoilGQPVPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR
Ga0318565_1060245213300031799SoilYNVATGQPEPYGSDGVDINCAVIGYTAQAPTANLASPVPNSQFPPR
Ga0318497_1042116323300031805SoilGTGQPQPYGSVGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR
Ga0318568_1010240543300031819SoilPYGSVGVDINCAVIGFTEEPPTANLEPPAPNSQFPPR
Ga0318568_1080449723300031819SoilPYGSVGVDINCAVIGWTGDEPPLANLADPVPNSQFPPR
Ga0318567_1012496043300031821SoilPATGQPEPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR
Ga0307478_1092074323300031823Hardwood Forest SoilDPATGQSEPYGSVGVDINCAVIGYTASAPTANLAPNIPGSQFPPR
Ga0310917_1003484113300031833SoilAGNPATGQPEPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR
Ga0310917_1021243533300031833SoilGSDGTDINCAVIGYTNKAPTANLAPPAPGSQFPPR
Ga0318511_1021655723300031845SoilQLYGSVGVDINCAVIGYTAKAPTTPGPANLPGSQFPPR
Ga0318522_1007410713300031894SoilYGSVGVDINCAVIGFTANAPTANLASPAPDSQFPPR
Ga0307406_1186028323300031901RhizosphereGSVGVDINCAVLGFTAKAPTANLANPLPNSQFPPR
Ga0306921_1131019013300031912SoilEPYGSVGVDINCAVIGYTATAPTANLAPPAPGSQFPPR
Ga0306921_1157833523300031912SoilQPQPYGSVGVDINCAVIGYTATAPTANLAQPAPGSQFPPR
Ga0306926_1167937113300031954SoilGQPTPYGSVGVDINCAVIGFTDKAPTANLAAPVPNSQFPPR
Ga0306926_1261864923300031954SoilATGKPAPYGSVGVDINCAVIGFTEKAPTANLAEPVPGSQFPPR
Ga0307479_1180227513300031962Hardwood Forest SoilLITGPGGAPYGSVGIDINCAVIGFTNEPPTANLVAPAPNSQFPPR
Ga0318531_1031855613300031981SoilGTGQPQPYGSAGVDINCAVIGYTAKAPTANLVPPAPNSQFPPR
Ga0306922_1039699123300032001SoilQAEPYGSVGVDINCAVIGYTATAPTANLAPPAPGSQFPPR
Ga0306922_1050528733300032001SoilTGQPEPYGSDGVDINCAVIGYTATAPTANLASPVPNSQFPPR
Ga0318569_1018287613300032010SoilVDPATGQPAPYGAVGVDINCAVIGFTNQAPTANLATPAPNSQFPPR
Ga0318507_1045113513300032025SoilPYGSAGVDINCAVIGYTATAPTANLAPPAPGSQFPPR
Ga0318506_1007975713300032052SoilATGQPVPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR
Ga0318570_1056686513300032054SoilGGAPYGSAGVDINCAVIGFTDDAPTANLEPPAPNSQFPPR
Ga0318505_1060303323300032060SoilPATVQPQPYGSAGVDINCAPTANLAPPAPNSQFPPR
Ga0318504_1003386713300032063SoilVNPATGQPTPYGSVGVDINCAVIGYTNQAPTANLAAPVPGSQFPPR
Ga0318514_1039466913300032066SoilPAPYGSVGVDINCAVIGFTEKAPTANLADPVPGSQFPPR
Ga0318553_1005559513300032068SoilYGSDGVDINCAVIGYTAQAPTANLASPVPNSQFPPR
Ga0318553_1018957333300032068SoilPYGSVGVDINCAVIGYTATAPTANLASPAPDSQFPPR
Ga0308173_1134756633300032074SoilGSVGVDINCAVIGFTAKAPTANLADPVPGSQFPPR
Ga0306924_1230351613300032076SoilGAVGVDINCAVIGFTSKAPTANLATPAPNSQFPPR
Ga0307471_10111653633300032180Hardwood Forest SoilYGATGVDINCAVIGFTHKAPTANLATPLPNSQFPPR
Ga0307471_10325697123300032180Hardwood Forest SoilTGPGGAPYGSVGIDINCAVIGFIDEAPTANLVAPAPNSQFPPR
Ga0307472_10209122813300032205Hardwood Forest SoilGGAPYGAAGVDINCAVIGFTDKAPTANLAQPVPGSQFPPR
Ga0306920_10100778013300032261SoilPYGSAGVDINCAVIGYTAQAPTANLAPPAPGSQFPPR
Ga0306920_10142455133300032261SoilPATGQPQPYGSVGVDINCAVIGYTNKAPTANLVPPAPNSQFPPR
Ga0306920_10330831823300032261SoilATGHPAPYGSAGVDIDCAVIGFINRPPTANLAPPVPHSQFPPR
Ga0335072_1020976043300032898SoilGQPQLYGSVGVDINCAVIGYTAKAPTTPGPPNLPGSQFPPR
Ga0335072_1032906123300032898SoilATGQPQLYGSVGVDINCAVIGYTATAPTSPGPPSLPGSQFPPR
Ga0335077_1058403823300033158SoilATGQPEPYGSVGVDINCAVIGYTATAPTANLAPPAPGSQFPPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.