NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F008284

Metagenome Family F008284

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F008284
Family Type Metagenome
Number of Sequences 335
Average Sequence Length 46 residues
Representative Sequence MVEQTYHEVLSTVVNELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Number of Associated Samples 27
Number of Associated Scaffolds 334

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.62 %
% of genes near scaffold ends (potentially truncated) 20.30 %
% of genes from short scaffolds (< 2000 bps) 58.81 %
Associated GOLD sequencing projects 27
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (94.030 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(72.537 % of family members)
Environment Ontology (ENVO) Unclassified
(99.701 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(85.373 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.67%    β-sheet: 0.00%    Coil/Unstructured: 41.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 334 Family Scaffolds
PF13952DUF4216 2.10
PF13960DUF4218 0.90
PF14299PP2 0.30
PF031712OG-FeII_Oxy 0.30
PF07983X8 0.30
PF14223Retrotran_gag_2 0.30
PF07714PK_Tyr_Ser-Thr 0.30
PF03140DUF247 0.30
PF00069Pkinase 0.30
PF02458Transferase 0.30
PF02992Transposase_21 0.30
PF00067p450 0.30
PF13963Transpos_assoc 0.30

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 334 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.40
COG2124Cytochrome P450Defense mechanisms [V] 0.30


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.33 %
UnclassifiedrootN/A5.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300018476|Ga0190274_13178598All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus553Open in IMG/M
3300028786|Ga0307517_10002781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta27834Open in IMG/M
3300028786|Ga0307517_10022355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7926Open in IMG/M
3300028786|Ga0307517_10049710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4282Open in IMG/M
3300028786|Ga0307517_10077128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2899Open in IMG/M
3300028786|Ga0307517_10081270All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2764Open in IMG/M
3300028786|Ga0307517_10082704All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2722Open in IMG/M
3300028786|Ga0307517_10085417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2643Open in IMG/M
3300028786|Ga0307517_10088050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2571Open in IMG/M
3300028786|Ga0307517_10093325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2440Open in IMG/M
3300028786|Ga0307517_10124010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1894Open in IMG/M
3300028786|Ga0307517_10177447All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1383Open in IMG/M
3300028786|Ga0307517_10201028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1245Open in IMG/M
3300028786|Ga0307517_10237742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1084Open in IMG/M
3300028786|Ga0307517_10266458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus989Open in IMG/M
3300028786|Ga0307517_10317702All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides863Open in IMG/M
3300028786|Ga0307517_10317722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus863Open in IMG/M
3300028786|Ga0307517_10369289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus771Open in IMG/M
3300028786|Ga0307517_10397585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica730Open in IMG/M
3300028786|Ga0307517_10503685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica615Open in IMG/M
3300028786|Ga0307517_10522006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica599Open in IMG/M
3300028786|Ga0307517_10578378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica556Open in IMG/M
3300028786|Ga0307517_10584444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica552Open in IMG/M
3300028786|Ga0307517_10588858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus549Open in IMG/M
3300028786|Ga0307517_10593627All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa546Open in IMG/M
3300028786|Ga0307517_10639888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica518Open in IMG/M
3300028794|Ga0307515_10013628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus15158Open in IMG/M
3300028794|Ga0307515_10019862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa12043Open in IMG/M
3300028794|Ga0307515_10070360All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4762Open in IMG/M
3300028794|Ga0307515_10070630All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4748Open in IMG/M
3300028794|Ga0307515_10070945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4730Open in IMG/M
3300028794|Ga0307515_10107278All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3303Open in IMG/M
3300028794|Ga0307515_10121687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2950Open in IMG/M
3300028794|Ga0307515_10126766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2844Open in IMG/M
3300028794|Ga0307515_10132161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2740Open in IMG/M
3300028794|Ga0307515_10190763All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1960Open in IMG/M
3300028794|Ga0307515_10208686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1804Open in IMG/M
3300028794|Ga0307515_10226158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1675Open in IMG/M
3300028794|Ga0307515_10235588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1612Open in IMG/M
3300028794|Ga0307515_10309118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1257Open in IMG/M
3300028794|Ga0307515_10358536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1100Open in IMG/M
3300028794|Ga0307515_10366330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1079Open in IMG/M
3300028794|Ga0307515_10511088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides811Open in IMG/M
3300028794|Ga0307515_10539239All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa776Open in IMG/M
3300028794|Ga0307515_10592722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus718Open in IMG/M
3300028794|Ga0307515_10750959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides594Open in IMG/M
3300030521|Ga0307511_10031849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4701Open in IMG/M
3300030521|Ga0307511_10054848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides3136Open in IMG/M
3300030521|Ga0307511_10055969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3089Open in IMG/M
3300030521|Ga0307511_10186960All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1103Open in IMG/M
3300030521|Ga0307511_10203787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1022Open in IMG/M
3300030521|Ga0307511_10267893All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica802Open in IMG/M
3300030521|Ga0307511_10305752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides714Open in IMG/M
3300030521|Ga0307511_10309771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides706Open in IMG/M
3300030521|Ga0307511_10327911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus672Open in IMG/M
3300030521|Ga0307511_10380964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica590Open in IMG/M
3300030521|Ga0307511_10415299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides546Open in IMG/M
3300030521|Ga0307511_10433363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus526Open in IMG/M
3300030522|Ga0307512_10130424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1579Open in IMG/M
3300030522|Ga0307512_10132314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1559Open in IMG/M
3300030522|Ga0307512_10203587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1066Open in IMG/M
3300030522|Ga0307512_10205517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1057Open in IMG/M
3300030522|Ga0307512_10340779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica667Open in IMG/M
3300030522|Ga0307512_10343148All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa663Open in IMG/M
3300030522|Ga0307512_10386831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus595Open in IMG/M
3300030522|Ga0307512_10391670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa588Open in IMG/M
3300030522|Ga0307512_10420372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides552Open in IMG/M
3300031456|Ga0307513_10017429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus8612Open in IMG/M
3300031456|Ga0307513_10030296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6147Open in IMG/M
3300031456|Ga0307513_10036619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5469Open in IMG/M
3300031456|Ga0307513_10051999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides4414Open in IMG/M
3300031456|Ga0307513_10078162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides3423Open in IMG/M
3300031456|Ga0307513_10084032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3271Open in IMG/M
3300031456|Ga0307513_10087299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3193Open in IMG/M
3300031456|Ga0307513_10105518All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2826Open in IMG/M
3300031456|Ga0307513_10116152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2656Open in IMG/M
3300031456|Ga0307513_10116595All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2649Open in IMG/M
3300031456|Ga0307513_10119966All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2600Open in IMG/M
3300031456|Ga0307513_10129696All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2469Open in IMG/M
3300031456|Ga0307513_10135566All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2398Open in IMG/M
3300031456|Ga0307513_10147265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2270Open in IMG/M
3300031456|Ga0307513_10164011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2109Open in IMG/M
3300031456|Ga0307513_10223108All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1703Open in IMG/M
3300031456|Ga0307513_10267613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1494Open in IMG/M
3300031456|Ga0307513_10267767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1493Open in IMG/M
3300031456|Ga0307513_10318099All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1315Open in IMG/M
3300031456|Ga0307513_10409903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1087Open in IMG/M
3300031456|Ga0307513_10421616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1064Open in IMG/M
3300031456|Ga0307513_10429646All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1049Open in IMG/M
3300031456|Ga0307513_10472173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides975Open in IMG/M
3300031456|Ga0307513_10518436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica907Open in IMG/M
3300031456|Ga0307513_10643485All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica767Open in IMG/M
3300031456|Ga0307513_10683439All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides732Open in IMG/M
3300031456|Ga0307513_10774992All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus664Open in IMG/M
3300031456|Ga0307513_11071024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica517Open in IMG/M
3300031456|Ga0307513_11098309All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides507Open in IMG/M
3300031507|Ga0307509_10099565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2948Open in IMG/M
3300031507|Ga0307509_10104492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2857Open in IMG/M
3300031507|Ga0307509_10149823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2251Open in IMG/M
3300031507|Ga0307509_10183519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1953Open in IMG/M
3300031507|Ga0307509_10278730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1434Open in IMG/M
3300031507|Ga0307509_10379207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1127Open in IMG/M
3300031507|Ga0307509_10392517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1097Open in IMG/M
3300031507|Ga0307509_10481742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides928Open in IMG/M
3300031507|Ga0307509_10581552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus794Open in IMG/M
3300031507|Ga0307509_10583040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica792Open in IMG/M
3300031507|Ga0307509_10667414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa707Open in IMG/M
3300031507|Ga0307509_10703073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus677Open in IMG/M
3300031507|Ga0307509_10768795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides628Open in IMG/M
3300031507|Ga0307509_10818931Not Available595Open in IMG/M
3300031507|Ga0307509_10878375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides561Open in IMG/M
3300031507|Ga0307509_10978763All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus512Open in IMG/M
3300031616|Ga0307508_10023764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5565Open in IMG/M
3300031616|Ga0307508_10055547All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3507Open in IMG/M
3300031616|Ga0307508_10069729All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica3087Open in IMG/M
3300031616|Ga0307508_10087225All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2705Open in IMG/M
3300031616|Ga0307508_10117170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2265Open in IMG/M
3300031616|Ga0307508_10124213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2183Open in IMG/M
3300031616|Ga0307508_10141131All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2013Open in IMG/M
3300031616|Ga0307508_10143996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1987Open in IMG/M
3300031616|Ga0307508_10154029All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1902Open in IMG/M
3300031616|Ga0307508_10180629All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1712Open in IMG/M
3300031616|Ga0307508_10197445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1613Open in IMG/M
3300031616|Ga0307508_10250752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1366Open in IMG/M
3300031616|Ga0307508_10285810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1242Open in IMG/M
3300031616|Ga0307508_10363917All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1037Open in IMG/M
3300031616|Ga0307508_10404389All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa956Open in IMG/M
3300031616|Ga0307508_10435332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus903Open in IMG/M
3300031616|Ga0307508_10494513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus817Open in IMG/M
3300031616|Ga0307508_10512892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica794Open in IMG/M
3300031616|Ga0307508_10515791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica791Open in IMG/M
3300031616|Ga0307508_10678303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides638Open in IMG/M
3300031616|Ga0307508_10690313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica629Open in IMG/M
3300031616|Ga0307508_10705755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa618Open in IMG/M
3300031616|Ga0307508_10730858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides601Open in IMG/M
3300031616|Ga0307508_10751632All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus588Open in IMG/M
3300031616|Ga0307508_10752077All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus588Open in IMG/M
3300031616|Ga0307508_10775987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa573Open in IMG/M
3300031616|Ga0307508_10847213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides535Open in IMG/M
3300031616|Ga0307508_10883720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica518Open in IMG/M
3300031616|Ga0307508_10910782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides506Open in IMG/M
3300031649|Ga0307514_10032565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4170Open in IMG/M
3300031649|Ga0307514_10046665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica3384Open in IMG/M
3300031649|Ga0307514_10051717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3181Open in IMG/M
3300031649|Ga0307514_10092269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2203Open in IMG/M
3300031649|Ga0307514_10142056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1630Open in IMG/M
3300031649|Ga0307514_10196916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1273Open in IMG/M
3300031649|Ga0307514_10225751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1142Open in IMG/M
3300031649|Ga0307514_10225849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1142Open in IMG/M
3300031649|Ga0307514_10225935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1141Open in IMG/M
3300031649|Ga0307514_10256095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1030Open in IMG/M
3300031649|Ga0307514_10270189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica985Open in IMG/M
3300031649|Ga0307514_10301344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus897Open in IMG/M
3300031649|Ga0307514_10320427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides851Open in IMG/M
3300031649|Ga0307514_10333966All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus821Open in IMG/M
3300031649|Ga0307514_10345352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus797Open in IMG/M
3300031649|Ga0307514_10386534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides723Open in IMG/M
3300031649|Ga0307514_10390335All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus717Open in IMG/M
3300031649|Ga0307514_10397534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa705Open in IMG/M
3300031649|Ga0307514_10397642All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus705Open in IMG/M
3300031649|Ga0307514_10500855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides577Open in IMG/M
3300031649|Ga0307514_10539748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides541Open in IMG/M
3300031649|Ga0307514_10540218All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica541Open in IMG/M
3300031649|Ga0307514_10543449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides538Open in IMG/M
3300031730|Ga0307516_10050938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4060Open in IMG/M
3300031730|Ga0307516_10064999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3525Open in IMG/M
3300031730|Ga0307516_10081427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3080Open in IMG/M
3300031730|Ga0307516_10095634All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2792Open in IMG/M
3300031730|Ga0307516_10116257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2470Open in IMG/M
3300031730|Ga0307516_10138716All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2203Open in IMG/M
3300031730|Ga0307516_10252744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1456Open in IMG/M
3300031730|Ga0307516_10309110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1254Open in IMG/M
3300031730|Ga0307516_10416108All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1002Open in IMG/M
3300031730|Ga0307516_10426133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus984Open in IMG/M
3300031730|Ga0307516_10491088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica882Open in IMG/M
3300031730|Ga0307516_10513435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica852Open in IMG/M
3300031730|Ga0307516_10663126All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides698Open in IMG/M
3300031730|Ga0307516_10692223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica676Open in IMG/M
3300031730|Ga0307516_10695321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides673Open in IMG/M
3300031730|Ga0307516_10779914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides616Open in IMG/M
3300031730|Ga0307516_10799652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica604Open in IMG/M
3300031730|Ga0307516_10811546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus597Open in IMG/M
3300031730|Ga0307516_10832670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica585Open in IMG/M
3300031730|Ga0307516_10873220Not Available564Open in IMG/M
3300031730|Ga0307516_10897904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa552Open in IMG/M
3300031730|Ga0307516_10910789Not Available546Open in IMG/M
3300031730|Ga0307516_10912351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica545Open in IMG/M
3300031730|Ga0307516_10934940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica535Open in IMG/M
3300031730|Ga0307516_10937961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides534Open in IMG/M
3300031730|Ga0307516_10970111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus520Open in IMG/M
3300031730|Ga0307516_10984789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus514Open in IMG/M
3300031838|Ga0307518_10019892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4822Open in IMG/M
3300031838|Ga0307518_10036269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3583Open in IMG/M
3300031838|Ga0307518_10126330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1803Open in IMG/M
3300031838|Ga0307518_10140855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1682Open in IMG/M
3300031838|Ga0307518_10141150All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1680Open in IMG/M
3300031838|Ga0307518_10174946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1458Open in IMG/M
3300031838|Ga0307518_10291774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus999Open in IMG/M
3300031838|Ga0307518_10348580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica864Open in IMG/M
3300031838|Ga0307518_10371822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides817Open in IMG/M
3300031838|Ga0307518_10409165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa751Open in IMG/M
3300031838|Ga0307518_10425408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides726Open in IMG/M
3300031838|Ga0307518_10467262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides666Open in IMG/M
3300031838|Ga0307518_10470721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides662Open in IMG/M
3300032354|Ga0325403_1005506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus11957Open in IMG/M
3300032354|Ga0325403_1005506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus11957Open in IMG/M
3300032354|Ga0325403_1010988Not Available8605Open in IMG/M
3300032354|Ga0325403_1015328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7154Open in IMG/M
3300032354|Ga0325403_1017329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6657Open in IMG/M
3300032354|Ga0325403_1019419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica6201Open in IMG/M
3300032354|Ga0325403_1019555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6167Open in IMG/M
3300032354|Ga0325403_1020304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6013Open in IMG/M
3300032354|Ga0325403_1021884All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5735Open in IMG/M
3300032354|Ga0325403_1035984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3955Open in IMG/M
3300032354|Ga0325403_1039080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica3689Open in IMG/M
3300032354|Ga0325403_1047031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica3117Open in IMG/M
3300032354|Ga0325403_1059363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2432Open in IMG/M
3300032354|Ga0325403_1067458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2091Open in IMG/M
3300032354|Ga0325403_1071287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1946Open in IMG/M
3300032354|Ga0325403_1084788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1529Open in IMG/M
3300032354|Ga0325403_1122573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus865Open in IMG/M
3300032354|Ga0325403_1122885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus861Open in IMG/M
3300032354|Ga0325403_1141090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus699Open in IMG/M
3300032354|Ga0325403_1146854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides652Open in IMG/M
3300032355|Ga0325401_1009452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9482Open in IMG/M
3300032355|Ga0325401_1038210All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3995Open in IMG/M
3300032355|Ga0325401_1045669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3458Open in IMG/M
3300032355|Ga0325401_1051472All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3129Open in IMG/M
3300032355|Ga0325401_1081067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2004Open in IMG/M
3300032355|Ga0325401_1103163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1509Open in IMG/M
3300032355|Ga0325401_1111918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1364Open in IMG/M
3300032355|Ga0325401_1131154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1111Open in IMG/M
3300032355|Ga0325401_1144141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides985Open in IMG/M
3300032355|Ga0325401_1198013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica669Open in IMG/M
3300032355|Ga0325401_1205522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus638Open in IMG/M
3300032374|Ga0325400_1004111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae13408Open in IMG/M
3300032374|Ga0325400_1014931All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7399Open in IMG/M
3300032374|Ga0325400_1020392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6234Open in IMG/M
3300032374|Ga0325400_1027251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides5238Open in IMG/M
3300032374|Ga0325400_1032738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4651Open in IMG/M
3300032374|Ga0325400_1035046All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica4447Open in IMG/M
3300032374|Ga0325400_1081039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2301Open in IMG/M
3300032374|Ga0325400_1158256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1161Open in IMG/M
3300032389|Ga0325405_1000771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida31331Open in IMG/M
3300032389|Ga0325405_1004877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus13644Open in IMG/M
3300032389|Ga0325405_1007827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10710Open in IMG/M
3300032389|Ga0325405_1009133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica9742Open in IMG/M
3300032389|Ga0325405_1009184Not Available9706Open in IMG/M
3300032389|Ga0325405_1021401All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5590Open in IMG/M
3300032389|Ga0325405_1023078All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5266Open in IMG/M
3300032389|Ga0325405_1047071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2707Open in IMG/M
3300032389|Ga0325405_1067108All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1690Open in IMG/M
3300032389|Ga0325405_1070585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1557Open in IMG/M
3300032389|Ga0325405_1075912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1375Open in IMG/M
3300032389|Ga0325405_1085818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1103Open in IMG/M
3300032389|Ga0325405_1088514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1044Open in IMG/M
3300032389|Ga0325405_1118922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus620Open in IMG/M
3300032390|Ga0325404_1005162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus13791Open in IMG/M
3300032390|Ga0325404_1040057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3186Open in IMG/M
3300032390|Ga0325404_1076039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1285Open in IMG/M
3300032390|Ga0325404_1081357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1131Open in IMG/M
3300032390|Ga0325404_1087903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica979Open in IMG/M
3300032735|Ga0325410_1006688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus12647Open in IMG/M
3300032735|Ga0325410_1016277All Organisms → cellular organisms → Eukaryota7320Open in IMG/M
3300032735|Ga0325410_1025587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5123Open in IMG/M
3300032735|Ga0325410_1128795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides507Open in IMG/M
3300032740|Ga0325411_1036096All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae3612Open in IMG/M
3300032741|Ga0325414_1001734All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta21487Open in IMG/M
3300032741|Ga0325414_1016986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7167Open in IMG/M
3300032741|Ga0325414_1019970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida6402Open in IMG/M
3300033160|Ga0325402_1025633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5089Open in IMG/M
3300033179|Ga0307507_10048296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica4142Open in IMG/M
3300033179|Ga0307507_10051512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3960Open in IMG/M
3300033179|Ga0307507_10063201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3430Open in IMG/M
3300033179|Ga0307507_10090777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2620Open in IMG/M
3300033179|Ga0307507_10192451All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1430Open in IMG/M
3300033179|Ga0307507_10209487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1332Open in IMG/M
3300033179|Ga0307507_10209991All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1329Open in IMG/M
3300033179|Ga0307507_10230359All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1229Open in IMG/M
3300033179|Ga0307507_10281070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1040Open in IMG/M
3300033179|Ga0307507_10397346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus785Open in IMG/M
3300033179|Ga0307507_10410293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides765Open in IMG/M
3300033179|Ga0307507_10427914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus740Open in IMG/M
3300033179|Ga0307507_10434649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides731Open in IMG/M
3300033179|Ga0307507_10457876All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus702Open in IMG/M
3300033179|Ga0307507_10495722Not Available660Open in IMG/M
3300033179|Ga0307507_10566949All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides594Open in IMG/M
3300033179|Ga0307507_10576471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides587Open in IMG/M
3300033180|Ga0307510_10016369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides8751Open in IMG/M
3300033180|Ga0307510_10085531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3029Open in IMG/M
3300033180|Ga0307510_10138817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2080Open in IMG/M
3300033180|Ga0307510_10170718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1754Open in IMG/M
3300033180|Ga0307510_10202721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1516Open in IMG/M
3300033180|Ga0307510_10242381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1296Open in IMG/M
3300033180|Ga0307510_10427090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus767Open in IMG/M
3300033180|Ga0307510_10437822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides748Open in IMG/M
3300033180|Ga0307510_10481114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus683Open in IMG/M
3300033180|Ga0307510_10511308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica644Open in IMG/M
3300033180|Ga0307510_10579461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica571Open in IMG/M
3300033180|Ga0307510_10633919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus524Open in IMG/M
3300034389|Ga0325419_013579All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus8088Open in IMG/M
3300034389|Ga0325419_046605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2671Open in IMG/M
3300034389|Ga0325419_053080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2251Open in IMG/M
3300034389|Ga0325419_111213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica714Open in IMG/M
3300034688|Ga0325420_020041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica5566Open in IMG/M
3300034688|Ga0325420_022368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5162Open in IMG/M
3300034688|Ga0325420_036465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3479Open in IMG/M
3300034688|Ga0325420_037205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3421Open in IMG/M
3300034688|Ga0325420_061235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2068Open in IMG/M
3300034688|Ga0325420_100576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1055Open in IMG/M
3300034689|Ga0325421_011641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides8020Open in IMG/M
3300034689|Ga0325421_026569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4458Open in IMG/M
3300034689|Ga0325421_050006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2435Open in IMG/M
3300034689|Ga0325421_075557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1418Open in IMG/M
3300034689|Ga0325421_076297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1398Open in IMG/M
3300034689|Ga0325421_089205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1100Open in IMG/M
3300034689|Ga0325421_092738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1037Open in IMG/M
3300034778|Ga0325423_009563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9631Open in IMG/M
3300034778|Ga0325423_011592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus8533Open in IMG/M
3300034778|Ga0325423_053732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2172Open in IMG/M
3300034899|Ga0325407_011144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides8728Open in IMG/M
3300034899|Ga0325407_048423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2644Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza72.54%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem20.00%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf7.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.30%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034778Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4Host-AssociatedOpen in IMG/M
3300034899Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0190274_1317859813300018476SoilMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLYRARLTSKRRNL
Ga0307517_10002781303300028786EctomycorrhizaMVEQTYHKVLSVVVNELLHPLLAILTPHVRLNKQLHWARLTSKRHNL
Ga0307517_1002235513300028786EctomycorrhizaMVEQTYHKVLSTVVNELLRPLLAVLTPHVRLHKQLHRAQLMSKRRSL
Ga0307517_1004971013300028786EctomycorrhizaMVEQTYHEVLSTIVNELLRLLLAILTPYVCLHKQLYRARLTSKRRSL
Ga0307517_1007712843300028786EctomycorrhizaMVEQTYHKVLSTVVNELLRLLLVVLTSHVRLNKQLYWDRLTSKRRSL
Ga0307517_1008127033300028786EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTLHVRLHKQLHRARLTSKRRSL
Ga0307517_1008270433300028786EctomycorrhizaMVEQTYHEVLSMVVNELLRSLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307517_1008541743300028786EctomycorrhizaMVEQTYHEVLSTVVNELLCPLLAVLTPHVCLHEQLHQARLTSKRRSL
Ga0307517_1008805033300028786EctomycorrhizaMVEQTYHKVLSTIVNELLRHFLAVLTPHVRLNKQLHWARLMSKRRSL
Ga0307517_1009332523300028786EctomycorrhizaMVEQTYQKVLSTVVNELLRPLLAVLTPHVRLNKQLHWARLTSKRRSL
Ga0307517_1012401033300028786EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLVVLTPHVRLHKQLHRARLTSKRRIL
Ga0307517_1017744723300028786EctomycorrhizaMVEQTYHEVLSTVVNKLLHPLLAVLTPHVRLHKQLHRAQLTSKRRSL
Ga0307517_1020102813300028786EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVHLHKKLHRARLTSKRRSL
Ga0307517_1023774213300028786EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307517_1026645813300028786EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTPHVHLHKQLHRARLMSKRR
Ga0307517_1031770223300028786EctomycorrhizaMVERTYHEVLSAVVNKLLHALVVVFTPHVHLYKQLHWARLTSKRRSL
Ga0307517_1031772213300028786EctomycorrhizaMVEQTYHDVLSTVVNELLRPLLAVLTPHVRLHKQLHRARLTSKRRSR
Ga0307517_1036928913300028786EctomycorrhizaMIERTCHEVLSTVVHELLHPLLAVLTSHVRLYKQLHWARLTSKRRSL
Ga0307517_1039758523300028786EctomycorrhizaMVEQTYHEVLSTVVNELLRPFLAVLTPHVRLHKQLYQARLTSKRRSL
Ga0307517_1050368513300028786EctomycorrhizaNLLNKMVEQTYHEVLSTVVNELLRPLLAVLTPHVRLHKQLHWARLTSKRRSL
Ga0307517_1050632913300028786EctomycorrhizaMIEQTYYEVLSTVVHELLHPLLAVLTSHVRLYKQLH
Ga0307517_1052200613300028786EctomycorrhizaNNNLQNKMVEQTYHEVLSMVVNELLRPLLAVLTSHVSLHKQLHRARLTSKRRSL
Ga0307517_1057837813300028786EctomycorrhizaFNKHNNLQNKMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHQARLTSKRRSL
Ga0307517_1058444413300028786EctomycorrhizaLQNKMVEQTYHEMLSTVINELLRPLLAVLTPHVRLYKQLHRARLTSKRRSL
Ga0307517_1058885813300028786EctomycorrhizaMVERPYHEVLRVVVDELLHPLLAVFTPHVRLHKQLQWTRLTPKRQIN
Ga0307517_1059362723300028786EctomycorrhizaMVEQIYHEMLSTVINELLRPLLAVLTPHICLHKQLH
Ga0307517_1063988823300028786EctomycorrhizaMVEQTYHEMLSTVINELLCPLLAVLTPHMRLHKQLHRARLTSKRRSL
Ga0307515_10013628143300028794EctomycorrhizaMIEQTYHEVLSMVVHELLHPLLAVFTLHVRLDKQLYXAWLMSKRRSLEEKNVAS
Ga0307515_10019862113300028794EctomycorrhizaMVEQTYHEMLSTVVNELLRPLLAVLTPHVRLHKQLHRARLISKRRSL
Ga0307515_1007036053300028794EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTSHMCLHKQLLRARLTSKRRSL
Ga0307515_1007063023300028794EctomycorrhizaMIEQTYHEMLSMVVNELLRPFLAVLTPHVRLHKQFHRARLTSKRRSL
Ga0307515_1007094563300028794EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTSHMRLNKQLHIFTEQIKK
Ga0307515_1010274353300028794EctomycorrhizaMNEXTYHEVLSMVVHELLHPLLAVLISHMRLYKQLY
Ga0307515_1010727813300028794EctomycorrhizaMVERTYHKVLSVVVNELLHPLLAILTPHVRLNKQLHWARLTSKRRNL
Ga0307515_1012168723300028794EctomycorrhizaMVEQTYHEILSMVINELLRPLLVVLTPYVRLHKQLHRARLTSKRRSL
Ga0307515_1012676613300028794EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLVVLTPHVRLHKQLHRARLTSKRRSL
Ga0307515_1013216123300028794EctomycorrhizaMVERTYHKVLSAVLNELLHPFLAVLTPHVRLYKQLHWAWLTSKRRSLQEKN
Ga0307515_1019076323300028794EctomycorrhizaMVEQTYHEMLSTVINELLRPFLAVLTPHVRLHKQLHRARLMSKRRSL
Ga0307515_1020868613300028794EctomycorrhizaMVEQTYHEMLRTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307515_1022615823300028794EctomycorrhizaMVEQTYHEVLSTVVNELLRLFLTVLTPHVRLHKQLYQAWLTSKRRSL
Ga0307515_1023558813300028794EctomycorrhizaMFEQTYHKVLSTVVNELLRPLLAVLTPHVHLNKQLHWARLMSKRRSL
Ga0307515_1030911823300028794EctomycorrhizaMVEQTYHEVLSTVVNELLCPLLAVLTSHVRLHEQLHQARLTSKRRSL
Ga0307515_1035853613300028794EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQFHRARLTSKRRSL
Ga0307515_1036633013300028794EctomycorrhizaMVEQTYHIVLSAVVNELLHPLLAVFTTHVRLYKQLHWVQLTSKRRSL
Ga0307515_1040410033300028794EctomycorrhizaMIERTYYEVLSTVVHELLHPFLAVLTSHVRLYKQLH
Ga0307515_1051108813300028794EctomycorrhizaMIERTYHEVLSIVVHELLHPLLAVLTPHVRLYKQLHWARLTSKRRSL
Ga0307515_1053923913300028794EctomycorrhizaMVEQTYHKVLSVVVNELLHPLLAVLTPHVHLYKQLHWAQLTSKRRSL
Ga0307515_1059272223300028794EctomycorrhizaMVEQTYHEMACTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRS
Ga0307515_1075095913300028794EctomycorrhizaMVEQTYREMLSTVINELLRPLLAVLTPHMRLHKQLHRARLTSK
Ga0307511_1003184913300030521EctomycorrhizaMVEQTYHKMLSTVINELLRPFLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307511_1005484823300030521EctomycorrhizaMIEXTYHEVLSTVVHELLHPFLAVLTPHVRLYKQLHWARLTSKRRSL
Ga0307511_1005596933300030521EctomycorrhizaMVEQTYHEMLSTIINELLRPLLAVLTLHVRLHKQLHRAQLTSKRCSL
Ga0307511_1018696033300030521EctomycorrhizaMVERTYHKVLSVVINELLHPLLLVFTPHVRLYKQLHWAQLTSKRRSL
Ga0307511_1020378723300030521EctomycorrhizaMVEQTYHEVLNTVVNELLRPLLVVLTPHVRLHKQLHRARLTSKRRIL
Ga0307511_1026789313300030521EctomycorrhizaFNKHNNLQNKMVEQTYHEMLSTVINELLRPFLAVLTQHVRLHKQLNRARLTSKRRSL
Ga0307511_1030575213300030521EctomycorrhizaMVEQTYHEMLSTIINELLRPLLAVLTPHVRLHKQLHR
Ga0307511_1030977113300030521EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307511_1032791123300030521EctomycorrhizaMVEQIYHKVLSAVVNELLRPILVVLTPHVRLNKQLHWARLTSKRRSL
Ga0307511_1038096413300030521EctomycorrhizaMVEQTYHEMLSTVINELLSPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307511_1041529923300030521EctomycorrhizaMVEQTYHEMACTVINELLRPLLAVLTPHVRLHKQLHRARLTSKR
Ga0307511_1043336323300030521EctomycorrhizaMVEQTYHEMLRMVINELLRPLLAVLTPHVRLHKQLHRARLTSKRR
Ga0307512_1013042423300030522EctomycorrhizaMVERTYHEVLSAVVNELLHPFLAIFTPHVRLYKQLHWARLTSKRRSL
Ga0307512_1013231423300030522EctomycorrhizaMIERTYHKMLSTVAHELLHPLLAVLTPHVCLYKQLHWARLTSKRRSL
Ga0307512_1020358713300030522EctomycorrhizaMVERTYHKVLSVVVNELLRPLLAILTPHVRLNKQLHWARLTSKRRNL
Ga0307512_1020551713300030522EctomycorrhizaMVEQTYHEVLSAVVLKLLHPLLTIFLSHVCLYKQLHWA
Ga0307512_1034077913300030522EctomycorrhizaMVEQTYHKMLSTVVNELLRPLLAVLTPHMRLNKQLHWARLTSKRRGL
Ga0307512_1034314823300030522EctomycorrhizaMVERTYHKVLSAVVNELLHPLLTILTPHMHLNKQLHWARLTSKRR
Ga0307512_1038683113300030522EctomycorrhizaMVERTYYKVLSVVVNELLHPLLAVLTPHVRIYKQLHWALLMSKRRSL
Ga0307512_1039167023300030522EctomycorrhizaMVEQTYHEMLSTVVNELLRPLLAVLTPHVRLHKQLHRAW
Ga0307512_1042037223300030522EctomycorrhizaMIKQTYHKVLSTVVHELLHSLLAVLTPHVRLYKQLHWAQLMSKRHN
Ga0307513_1001742983300031456EctomycorrhizaMVEQTYLEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307513_1003029623300031456EctomycorrhizaMVEQTYHEMLSTVINELLHSLLAVLTPHVRLHKQLHRARLTSKRRSLQXKKIY
Ga0307513_1003661973300031456EctomycorrhizaMVEQTYHEVLRTVVNELLHPLLAILTPQVCLHKQLHRARLTSKRRSL
Ga0307513_1005199993300031456EctomycorrhizaMVERTYHKVLSVIVNELLHPLLAVLTPHVRLYKQLHWTQLTSKRRSM
Ga0307513_1007816233300031456EctomycorrhizaMVEQTYHEMLSTVINKLLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307513_1008403223300031456EctomycorrhizaMVERTYHKVLSAVVNELLHPFLAIFTPHVRLYKQLHWALLTSKRRSL
Ga0307513_1008729933300031456EctomycorrhizaMVEQTYHEMLSTVINELLRLLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307513_1010551833300031456EctomycorrhizaMVEQTYHEMLSTVINELLRPFLAVLTQHVRLHKQLNRARLTSKRRSL
Ga0307513_1011615213300031456EctomycorrhizaMVEQTYHKVLSAVVNKLFHPLLTVLTPHVRLNKQLHWAQLTSKRRSL
Ga0307513_1011659543300031456EctomycorrhizaMVEQTYHKVLSTVVNELLRLLLVFLTSHVRLNKQLYWDRLTSKRRSL
Ga0307513_1011996623300031456EctomycorrhizaMVEQTYHKVLSTVVNELLRPLLAVLTPHVRLHKQLNRAWLTSKRRSL
Ga0307513_1012969643300031456EctomycorrhizaMIEQTYHEMLSTVINELLRPFLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307513_1013556633300031456EctomycorrhizaMVEQTYHEVLSTVVNELLRPLMAVLTPHVRLHKQLHWAWLTSKRRSL
Ga0307513_1014726523300031456EctomycorrhizaMVEQTYHKVLSTVVNELLRPFLVVLTPHVRLHKQLHRARLMSKRRSL
Ga0307513_1016401123300031456EctomycorrhizaMVEQTYHEMLSTIINELLRPLLAVLTPHVRLHKQLYRAWLTSKRRNL
Ga0307513_1022310813300031456EctomycorrhizaMVEQTYYKVLSTVVNELLRPLLAVLTPHVRLNKQLHWARHTSKKRSL
Ga0307513_1026761323300031456EctomycorrhizaMVEQIYHEMLSTVINELLRPLLAVLTPHVRLHKQLHQARLTSKRRNL
Ga0307513_1026776723300031456EctomycorrhizaMVEQTYHEMLSTVINELLCPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307513_1031809913300031456EctomycorrhizaMVEQTYHKVLSTIVNELLRHLLAVLTPHVRLNKQLHWARL
Ga0307513_1040990313300031456EctomycorrhizaMIERTYHEVLSTVVHELLHPLLAVLTPHVRLYKQFHWA
Ga0307513_1042161623300031456EctomycorrhizaMIERTYHEVLSTVVHKLLNPLLAVLTPHVRLYKQLHWTRHTSKRRSL
Ga0307513_1042964613300031456EctomycorrhizaMIEQTYHEVLSMVVHELLHPLLAVLTPYVRLYKQLHWARLTSKRRSL
Ga0307513_1047033223300031456EctomycorrhizaMIERTYYEVLSMVVHELLHPLLAVMTSHVRLYKQLH
Ga0307513_1047217313300031456EctomycorrhizaMIERTFHEVLSTVVHELLHPLLAVLTPHMHLYKQLHWTRLMSKRRSL
Ga0307513_1051843623300031456EctomycorrhizaMIERIYHEVLNTVVHELLHPFLAVLTPHVRIYKQLHWARLTSKRRSL
Ga0307513_1064348523300031456EctomycorrhizaQFNKHNNLQNKMIEQTYHEMLSMVVNELLRPFLAVLTPHVRLHKQFHRARLTSKRRSL
Ga0307513_1068343923300031456EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVHLHKQLHRARLTS
Ga0307513_1077499213300031456EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHQARLTSKRRSL
Ga0307513_1098214013300031456EctomycorrhizaMIERTYHEVLSTVAHELLHPLLAVLTSHVRLYKQL
Ga0307513_1107102413300031456EctomycorrhizaMVERTYHKVLSVVVNELLHLLLAVLTLHVHLNKQLHWARLTSKRCSL
Ga0307513_1109830913300031456EctomycorrhizaMVEQTYREMLSTVINELLRPLLAVLTPHMRLHKQLHRARLTSKR
Ga0307509_1009956513300031507EctomycorrhizaMVEQTYHEMLSTVINELLRPLLSVLTPHVRLHKQLHRAQLTSKRRSL
Ga0307509_1010449223300031507EctomycorrhizaMIERIYHEVLSTVVHELLHPFLAVLTPHLRLYKQLHWAQHTSKRRSLYGKKKVVS
Ga0307509_1014982323300031507EctomycorrhizaMVEQTYHEMLSTIINELLRPLLAVLTPHVRLHKQLHRAWLTSKRRSL
Ga0307509_1015896733300031507EctomycorrhizaMIERTYHEVLSTVVHKLLYPLLAVLTSHVRLYKKLHWAAHVQET
Ga0307509_1018351923300031507EctomycorrhizaMVEQTYHEVLSMVVNELLRSLLAVLTPHVRLHKQLHQARLTSKRRSL
Ga0307509_1027873013300031507EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKR
Ga0307509_1037920723300031507EctomycorrhizaMVEQTYHEMLRIVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307509_1039251723300031507EctomycorrhizaMVEQTYHEMLSAVINELLRPLLAVLTPHMRLHKQLHRARLTSKRRNL
Ga0307509_1048174223300031507EctomycorrhizaMVEQTYHEVLSAVVLKLLHPLLTIFLSHMCLYKQLHWA
Ga0307509_1058155223300031507EctomycorrhizaMIEQTYHEVLSTVVHELLHPLLAVFTPHVRLDKQLHWARLTSKRRSLFEKNVAS
Ga0307509_1058304013300031507EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTPHVRLRKQLHRARLTSKRCSL
Ga0307509_1066741413300031507EctomycorrhizaMVERTYHKVLSVVVNELLHSLLAVLTPHVRLYKQLYWARFTSKRRSL
Ga0307509_1070307313300031507EctomycorrhizaMVERTYHEVLSTVVNELLHLLLAVLTLHVRLYKQLHWAWLTFKRRTL
Ga0307509_1076879513300031507EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTLHVRLHKQLHRARLTSKRRSL
Ga0307509_1081893113300031507EctomycorrhizaQENNNLRNKMDEQTYHEVLSAVVDELLHPSLAVFTPHMRLCKQLRWAQLTSKRHSL
Ga0307509_1087837513300031507EctomycorrhizaMIEQTYNEVLSMVVHELLHPLLAVFTPHMRLDKQLHWARLTSKRRSL
Ga0307509_1097876313300031507EctomycorrhizaMVERTYHEVLCMVVNKLLHPFFVVFTLHMCLYKKPHWARLMSKRRVIVQ
Ga0307508_1002376423300031616EctomycorrhizaMVEQTYHKVLSTVVNELLYPLLAVLTPHVRLNKQLHRAQLMSKKRSL
Ga0307508_1005554713300031616EctomycorrhizaMIERIYHEVLSMVVHELLHPLLEVLTPHVRLYKQLHWARLTSKRHSL
Ga0307508_1006972933300031616EctomycorrhizaMVEQTYHEMLSTIINELLRPLVAVLTPHVHLHKQLHRARLTSKRRSL
Ga0307508_1008722533300031616EctomycorrhizaMVEQTYHEVLSMVVNELLRPLLAVLTPHVRLHKQLHWARLTSKRRSL
Ga0307508_1011717033300031616EctomycorrhizaMVEQTYHKVLSTVVNELLRPLLAVLTPHVRLNKQLHWARLTSKIRSL
Ga0307508_1012421323300031616EctomycorrhizaMVEQTYHKVLCTVVNELLRPLLAVLTPHVRLNKQLYWARLTFKRRSL
Ga0307508_1014113113300031616EctomycorrhizaMIERTYHEVLSTVVHELLHPLLAVFTPHVRLDKQLHWARLTSKRRSLFEKNVAS
Ga0307508_1014399613300031616EctomycorrhizaMVEQTYHKMLSTVINELLRPFLAVLTPHVHLHKQLHRARLTSKRHSL
Ga0307508_1015402913300031616EctomycorrhizaMVEQTYHKVLTVVNELLRPLLAILTPHMHLNKQLYWVRLTSKRRSL
Ga0307508_1016369323300031616EctomycorrhizaMIERTYHKVLSTVVHELLHPFLAVLTPHVHPYKQLH
Ga0307508_1018062923300031616EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTPHVCLHKQLYRARLTSKRRSL
Ga0307508_1019744513300031616EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLT
Ga0307508_1025075233300031616EctomycorrhizaMVEQTYHETLSTVINELLRSLLTVLTPHVCLHKQLHRARLTSKRHSL
Ga0307508_1028581013300031616EctomycorrhizaMVEQTYHEMLSMVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307508_1036391713300031616EctomycorrhizaMVERTYHKVLSAVVNELLHPLLTVLTSHVRLHKQLHWARLTSKRRSL
Ga0307508_1040438923300031616EctomycorrhizaMVERTYHKVLSAVVNKLLHPLLAVLTSHVRLYKQLHWARLTSKRRSL
Ga0307508_1043533223300031616EctomycorrhizaMVEQTYHEMLSTIINELLRSLLAVLTPHVRLHKQLHQARLTFKRHNL
Ga0307508_1049451323300031616EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQFHRARL
Ga0307508_1049815213300031616EctomycorrhizaMVERTYHKVMSVDFNELLQIFLAVFTLHVRLYKEL
Ga0307508_1051289213300031616EctomycorrhizaMVEQTYHEMLSTVINELLRPFLAVLTLHVRLHKQLHRARLTSKRRNL
Ga0307508_1051579113300031616EctomycorrhizaMVEETYHEMLSTVINELLRPLLAVLTSHVRLHKQLHRARLTSKRRGL
Ga0307508_1067830313300031616EctomycorrhizaMVERTYHEVLSAVVNELLHPILAVFTLHVCLYKQLYWARLTSK
Ga0307508_1069031313300031616EctomycorrhizaNLQNKMVEQTYHEMLSTVINELLRPFLAVLTQHVRLHKQLNRARLTSKRRSL
Ga0307508_1070575523300031616EctomycorrhizaMVEQTYHEMLSTVINELLRPFLAVLTQHVRLHKQLNR
Ga0307508_1073085813300031616EctomycorrhizaMIEQTYHKVLSTVVHELLHSLLAVLTPHVRLYKQLYWAQLTSKRHNL
Ga0307508_1075163223300031616EctomycorrhizaMVERTYHKVLSAVVNKLLHLFLAVFTPHVRLNKQLHWARLMSKRRSCNEKN
Ga0307508_1075207713300031616EctomycorrhizaMVEQTYHKVLSTVVNELLRPLLAVLTPHMRLNKQLHWARLTSKRRSL
Ga0307508_1077598723300031616EctomycorrhizaMVEQTYHEVLSMVVNELLRPLLAVLTLHVRLHNQLHRA
Ga0307508_1084721313300031616EctomycorrhizaMIERTYHKVLRTVVHELLHPLLVVLTPHVRLYKQLHWARLTSKRRSL
Ga0307508_1088372013300031616EctomycorrhizaKMVEQTYHKVLSVVVNELLHPLLAILTPHVRLNKQLHWARLTSKRHNL
Ga0307508_1091078213300031616EctomycorrhizaMVEQTYHEVLSTVVNELLRPFLAILTPHVSLHKQLYRARLTSKRRSL
Ga0307514_1003256543300031649EctomycorrhizaMVEXTYHKVLSAVVNELLHPLLVVLTPHVRLNKQLHWA
Ga0307514_1004666543300031649EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRGL
Ga0307514_1005171763300031649EctomycorrhizaMVERTYHKVLSAVVNELLHPLLAVFTLHVRHYKQLNWARLTSKRRSQ
Ga0307514_1009226913300031649EctomycorrhizaMVEQIYHKVLSAVVNELLRPILVVLTPHVRLNKQLHWARLTSKRRSLQGKKLFK
Ga0307514_1014205613300031649EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTPHVRLYKQLHRARL
Ga0307514_1019691613300031649EctomycorrhizaMIEQTYHEVLSTAVQELLHPLLVVLSPYVRLYKQLHWARLTSKRRSLKGK
Ga0307514_1022575113300031649EctomycorrhizaMVEQTYHEMLSTVINELLHSLLAVLTPHVRLHKQLHRAR
Ga0307514_1022584923300031649EctomycorrhizaMVEQTYHKVLSAVVNELLCPLLTVWTPHVHLNKQLHWAWLTSKRRNLYGKKLIK
Ga0307514_1022593533300031649EctomycorrhizaMIEQTYHEVLSMVVHELLHPLLAVLTPYVCLYKQLHWARLTSKRRSL
Ga0307514_1025609513300031649EctomycorrhizaMIERTYHKVLRTVVHELLHLLLVVLTPHVRLYKQLHWARLTYKRRSL
Ga0307514_1027018913300031649EctomycorrhizaMVGQTYHEMLRTVINELLRPLLAVLTPHVRLHKQLNRARLASKRRSL
Ga0307514_1030134413300031649EctomycorrhizaMIEQTYHEVLSMVVHELLHPLLAVFTPYMSLDKQLYWARLMSKRRSLKEKNVAS
Ga0307514_1032042713300031649EctomycorrhizaMIDRTYHKVLSTVVHELLHPLLAVLTPHVRLYKQLHWTQLTSKRRSL
Ga0307514_1033396613300031649EctomycorrhizaMVEQTYYEMLSTVINELLRPLLAVLTPHVRLHKQLYRARLTSKRRSL
Ga0307514_1034535223300031649EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTPHVHLHKQLHRARLTSKRCSL
Ga0307514_1038653423300031649EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLYKQLHRARLM
Ga0307514_1039033513300031649EctomycorrhizaMIERTYHEVLRTVVHELLHPLLVVLTSHVRLYKQLHWARLTFKRRSL
Ga0307514_1039753413300031649EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKKLHRARLTSKRCSL
Ga0307514_1039764213300031649EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKIRSL
Ga0307514_1050085513300031649EctomycorrhizaMIERTYHEVLSMVVHKLLHPLLEVLTPHVRLYKQLHWARLT
Ga0307514_1053974823300031649EctomycorrhizaMLSMVINELLRPLLAVLTPHVRLHKQLHRARLTSK
Ga0307514_1054021813300031649EctomycorrhizaMVEQTYHEVLSTVVNELLRLLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307514_1054344913300031649EctomycorrhizaMVEQTYHKVLSTVVNELLHPLLAVLTPHMRLNKQLHWARLTSKRGSL
Ga0307516_1005093873300031730EctomycorrhizaMVEQTYHEVLSTVVNELLRPFLAVLTPHVRLNKQLHRARLTSKRHSL
Ga0307516_1006499913300031730EctomycorrhizaMVEQTYHEVLSTVVNKLLCPLLAVLTPHVRLHKQLHRAQLTSKRRILKXKKINYNKLI
Ga0307516_1008142713300031730EctomycorrhizaMVEQTYHEVLSTVVNELLHPFLAVLTPHVRLHKQLHRARLTSKRCNL
Ga0307516_1009563443300031730EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLEVLTPHVRLHKQLHRARLTSKRCSL
Ga0307516_1011625723300031730EctomycorrhizaMVEQIYLEVLSTVVNELLRPLLAVLTSHVRLHKQLHRARLTSKRRSL
Ga0307516_1013871633300031730EctomycorrhizaMVEQTYHEVLSTVVNEQLRPLLAVLTSHMRLHKQLHHARLMSKRRSL
Ga0307516_1025274423300031730EctomycorrhizaMIERIYHEVLSTVIHELLHPFLAVLTPHVRIYKQLHWARLTSKRRSL
Ga0307516_1030911023300031730EctomycorrhizaMVERTYHKVLSAVINELLHPLLVVFTPQVRLYKQIHWA
Ga0307516_1041610823300031730EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHMRLHKQLHRARLMSKRRSL
Ga0307516_1042613313300031730EctomycorrhizaMVERTYHKVLSVVVNELLHSLLAVLTPHVRLYKLLYWARFTSKRRSL
Ga0307516_1044551423300031730EctomycorrhizaMVERIYHEVLSAVVNELLHPLLAVFITHMRLYKQLH
Ga0307516_1049108813300031730EctomycorrhizaMVERTYYKVLSVVVNELLHPFLAVLTPHVRIYKQLHWALLMSKRRSL
Ga0307516_1051343513300031730EctomycorrhizaMVEQTYHEVLSTVVKELLRPLLAVLTPHVRLHKQLYRAWLTSKRRSL
Ga0307516_1066312623300031730EctomycorrhizaMVERTYHEVLSTVVNELLHPLLAVFTPHVRLYKQLHWARLTSKK
Ga0307516_1069222313300031730EctomycorrhizaNNLQNKMVEQTHQEMLSTVINELLRPLLAVLTPHVRLHKQLHWARLTSKRRSL
Ga0307516_1069532113300031730EctomycorrhizaMLERTYHEMLCTVVHKLLHPLLAVLTPHVRFYKQLHWLLPMESPTELFRR
Ga0307516_1077991413300031730EctomycorrhizaMIERTYHEVLSTVVHELLHSLLAVLTPYMHLYKQLHWARIISSASHVH
Ga0307516_1079965213300031730EctomycorrhizaLQNKMVEQTYHEMLSTVINELLRPLLAVLTPHMRLHKQLHRAQLTSKRRSL
Ga0307516_1081154613300031730EctomycorrhizaMVKQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKR
Ga0307516_1083267013300031730EctomycorrhizaHNNLQNKMVEQTYHEMLSTVINELLHPLLAVLTPHVRLLKQLHRARLTSKRRNL
Ga0307516_1087322013300031730EctomycorrhizaMDEQTYHEVLSAVVDELLHPPLAVFTPHMRLCKQLRWAQLTSKRHSL
Ga0307516_1089790413300031730EctomycorrhizaMVERTYHKVLSAVVNKLLHPLLAVLTSHVRLYKQLHWAR
Ga0307516_1091078923300031730EctomycorrhizaMDEQTYHEVLSAVVDELLHPHLAVFTPHMRLCKQLRWAQLTSKRHSL
Ga0307516_1091235113300031730EctomycorrhizaHNNLQNKMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307516_1093494023300031730EctomycorrhizaNNLQNKMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHQARLTSKRRSL
Ga0307516_1093796113300031730EctomycorrhizaMVEQTYHKVLSVVVNELLHPLLALLTPHVRLNKQLHWARLTSKRRRL
Ga0307516_1097011123300031730EctomycorrhizaMIERTYHKILSTVVHELLHPLLAVLTAHMRLYKQLHWARLTFKRRSL
Ga0307516_1098478913300031730EctomycorrhizaMVERTYHKVLSAVVNELLHPLLTILTPHMHLNKQLHWARLTSKRRSL
Ga0307518_1001989233300031838EctomycorrhizaMVEQTYHKVLSTIVNELLRHFLAVLTPHVRLNKQLHWALLMSKRRSL
Ga0307518_1003626933300031838EctomycorrhizaMVEQTYHEVLSTVVNELLRPFLAVLTPHMHLHKQLHRARLMSKRCSL
Ga0307518_1012633023300031838EctomycorrhizaMVEQIYLEVLSTVVNELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0307518_1014085523300031838EctomycorrhizaMVEQTYHKMLSAVVNELLRPLLAVLTPHVRLNKQLHWARLMSKRRSL
Ga0307518_1014115023300031838EctomycorrhizaMVERTYHKVLSVVVNELLHPLLAILTPHVRLNKQLHWARLTSKRHNL
Ga0307518_1017494613300031838EctomycorrhizaMVEQTYHEVLSTVVNELLRLLLAVLTPDVHLHKQLHRARLTSKRRSL
Ga0307518_1023715113300031838EctomycorrhizaMIERTYYEVLNMVVHELLHPLLAVLTSHVRLYKQLH
Ga0307518_1029177423300031838EctomycorrhizaMVERTYHKVLSTVVNELLHPLLAVLTSHVRLYKQLHWARLTSKRCSL
Ga0307518_1034858023300031838EctomycorrhizaMVERTYHKVLSAVVNELLHLLLKVFTPHVRLYKQLDWARLMSKRRSL
Ga0307518_1037182213300031838EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLH
Ga0307518_1040916523300031838EctomycorrhizaMVEQTYHEVLSTVVNELLCLLLAVLTLHVRLHKQLHRA
Ga0307518_1042540813300031838EctomycorrhizaMVEQTYHKVLSTVVNELLHPLLAVLTPHMRLNKQLHWARLTSKRR
Ga0307518_1046726213300031838EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPYVRLHKQLHR
Ga0307518_1047072113300031838EctomycorrhizaMIEQTYHEVLSMVVHELLHPLLAVFTPYMSLDKQLYWARLMSKRRSLKE
Ga0325403_100550613300032354XylemMVEQTYHEMLSMVVNELLRPLLAVLTPHVRLHKQLHRAQLTSKRRSL
Ga0325403_100550683300032354XylemMIKQTYHKVLNAVVNELLHPLLAVLTLHVRLNKQLHWAWLMSKRRSL
Ga0325403_101098833300032354XylemMVEQTYHKVLSTVVNELLHPLLAVLTSHVRLHKQLNQARLTSKRRSL
Ga0325403_101532813300032354XylemMVEQTYHEMLSTVINELLRPLLAVLTPHVCLHKQLHRAWLTSKRRSL
Ga0325403_101732933300032354XylemMVEQTYNEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0325403_101941953300032354XylemMVEQTYHEMLSTIINELLHPLLAVLTLHVRLHKQLHQARLTSKRCSL
Ga0325403_101955523300032354XylemMVEQTYHEVLSMVVNELLRPLLAVLTSHVRLHKQLHRARLTSKRRSL
Ga0325403_102030443300032354XylemMVEQTYHEILRTVINELLHPLMAVLTPHVCLHKQLHRARLTSKKRSL
Ga0325403_102188463300032354XylemMVEQTYHEMLSTVVNELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0325403_103598423300032354XylemMVEQTYHEMLSKVINELLRLLLVVLTLHMRLHKQLHRARLMFKRRNL
Ga0325403_103908033300032354XylemMVEQTYHEVLSTIVNELLRPLLAVFTPHMRLHKQLHRARLTSKRCSL
Ga0325403_104703123300032354XylemMVEQTYHEMLSTVINELLRPLLVVLTPHVRLHKQLHRAQLTSKRRSL
Ga0325403_105936323300032354XylemMVEQTYHEMLSTVINELLSSLLAVLTPHVRLHKQLQQARLTSKRRSL
Ga0325403_106745823300032354XylemMVEQTYHEMLSTVINELLRSLLAVLTPHVRLHKQLQRAWLTSKRRSL
Ga0325403_107128713300032354XylemMVEQTYHKMLSTIINELLRPLLAVLTSYVRLHKQLHRAQLTSKRRSL
Ga0325403_108478823300032354XylemMVEQTYHEMLSTVINELLRPLLAVLTLHMRLHKQLHRARLMSKRRSL
Ga0325403_112257323300032354XylemMVEQTYHEMLSTVINELLRPFLAVLIPHVRLHKQLHQAQLTSKRRSL
Ga0325403_112288513300032354XylemMVEQTYHKVLSTVVNELLGPLLAVLTLHVHLNKQLHWARFMFKRHSL
Ga0325403_114109013300032354XylemMVEQTYHEMLSTVINELLRPLLAVLTPHMRLHKQLHRARLTSKRRSL
Ga0325403_114685413300032354XylemMVEQTYHEMLSTVINELLRPLLAVLTPHMRLHKQL
Ga0325401_100945273300032355XylemMVEQTYHEVLSTVVNELLRPLLAVLTPHVRLHKQLHRAWLTSKRCSL
Ga0325401_103821043300032355XylemMVEQTYHEMLSTVINELLRPLLAVLTPHVRLYKQLHRARLTSKRRSL
Ga0325401_104566923300032355XylemMVEQTYHKMLSMIINEMLRLLLAVLTPHMHLHEQLHRA
Ga0325401_105147243300032355XylemMVEQTYHEVLSTDVNELLRPLLAVLTPHMRLHKQLHRARLTSKRHSL
Ga0325401_108106713300032355XylemMVKRTYHKVLSAVVNELLHPLMVVLTPHARLYKQLHWARFM
Ga0325401_110316333300032355XylemMVEQTYHEMLSTVINELLRPLMAVLTPHMRLHKQLHQARLTSKRRSL
Ga0325401_111191813300032355XylemMVEQTYHEMLSTVINELLCPLLAVLTLHVRLHKQLHRARLTSKRRSL
Ga0325401_113115423300032355XylemMVEQTYHKVLSTVVNELLGPLLAVLTPHVHLNKQLHWARFMFKRHSL
Ga0325401_114414123300032355XylemMVEQTYHEMLTMVVNELLRPLLAVLTPHVRLHKQLHRAQLTSKRRSL
Ga0325401_119801313300032355XylemNNLHNNLQNKMVEQTYHEMLSTVINELLRPLLAVLTPHMRLHKQLHRTRLTSKRRRL
Ga0325401_120552213300032355XylemMVERTYHKVLSAVVNELLHPFLAVFTPHVRHYKQLNWARLTSKRRNQ
Ga0325400_100411143300032374XylemMVEQTYHEVLSTVVNELLRSLLAVLTPHVRLYKQLHRARLTSKRCSL
Ga0325400_101493133300032374XylemMVEQTYHEVLSTVVNELLRPLLAVLTPHVRLHKQLYRAWLTSKRCSL
Ga0325400_102039253300032374XylemMVEQTYHEMLSTVINELLRTLLAVLTPHVRVHKQLHRARLTTKRRSL
Ga0325400_102725143300032374XylemMVEQTYHEILSTVINELLRRLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0325400_103273873300032374XylemMLSTVINELLRSLLAVLTPHVLLHKQLHRARFTSKRRSL
Ga0325400_103504663300032374XylemMVEQTYHKVLSTVVNELLGPLLAVLTSHVRLHKQLNRARLTSKRRSL
Ga0325400_108103933300032374XylemMVEQTYHEMLSTVFNELLLPILAVLTPHMRLHKQLHRARLTSKRHSL
Ga0325400_115825623300032374XylemMVEQTYHKELSTVVNELLRSLLAVLTSHVRLNKQLHWARLTSKRCSL
Ga0325405_1000771193300032389XylemMVEQTYHEVLSTVVNELLRSLLAVLTPHVRLHKQLHRAWLTSKRRSL
Ga0325405_1004877123300032389XylemMVEQTYHEMLSTVINELLRPLLTVLTPHVRLHKQLHQARLTSKRRGL
Ga0325405_1007827113300032389XylemMVEQTYHEMLSTVINELLHPLLAVLTPHVRFHKQLHQARLTSKSRSL
Ga0325405_100913323300032389XylemMVEQTYHEMLSMIINELLHPLLAVLTLHVRLHKQLHQARLTSKRCSL
Ga0325405_100918433300032389XylemMVEQTYHKVLSTVVNELLRPLLAVLTSHVRLHKQLNRARLTSKRRSL
Ga0325405_102140133300032389XylemMVEQTYHEMLSTVINEMLCPFLAVLTPHVRLHKQLHRAWLTSKRRSL
Ga0325405_102307833300032389XylemMVEQTYHEMLSTVINELLHPLLAVLTPHVRLHKQLHRARLTSKRRNL
Ga0325405_104707123300032389XylemMVDQTYHEVSSTVVNELLRSLLEVLTSHVRLHKQLHLAQLISKRRSL
Ga0325405_106710813300032389XylemMVEQTYQEVLSMVVNELLRPFLAVLTSHVRLHKQLHRAQLTSKRRSL
Ga0325405_107058523300032389XylemMVEQTYHEMLSTVINELLRPLLAVLTPHMCLHKQLHRARLTSKRRSL
Ga0325405_107591213300032389XylemMVEQTYHEMLSTVINELLRPLLTVLTPHVRLHKQLHRARLTSKRRNL
Ga0325405_108581823300032389XylemMVEQTYQEMLSTVINELLRPFLAVLTPHMRLHKQLHRARLTSKRRSL
Ga0325405_108851413300032389XylemMVEQTYHEMLSTVINELLRPLLAVLTPHMRLHKQLHRTRLTSKRRRL
Ga0325405_109816213300032389XylemMVERTYHKVLSMVVNELLHPFLAVLPLHVRLYKQLH
Ga0325405_111892213300032389XylemMVEQTYYKMLSTVINELLHPLLAVLTPYVRLHKQLHRARLTSKRRIL
Ga0325404_1005162113300032390XylemMVEQTYHEMLSTVINELLRPLLTVLTPHVRLHKQLHRARLTSKRRGL
Ga0325404_104005743300032390XylemMVEQTYHKMLSTIINELLRPLLAVLTPHVRLYKQIHRARLTSKRRGL
Ga0325404_107603913300032390XylemMVEQTYHEMLSTVINELLHPLLTVLTPHMRLHKQLHRARLTSKRGSL
Ga0325404_108135723300032390XylemMVEQTYQEMLNTVINELLRPFLAVLTPHMRLHKQLHRARLTSKRRSL
Ga0325404_108790313300032390XylemMVEQIYYEMLSTVINELLHPLLAVLTPYVRLHKQLHRARLTSKRRIL
Ga0325410_1006688113300032735XylemMVEQTYHEMLITVINELLRPLLTVLTLHMRLHKQFHRAWLTSKRRSL
Ga0325410_101627753300032735XylemMIEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0325410_102558733300032735XylemMVEQTYHKMLSTVINELLRPLLAVLTSHVRLHKQLNQARLTSKRRNL
Ga0325410_112879513300032735XylemMVEQTYHEMLSTVINELLLPLLAVLTPHMRLHKQLHRARLTSKRRSL
Ga0325411_103609633300032740XylemMVEQTYHEMLSTVINELLPPLLAVLTSHVRLHKQLHRARLTSKRRSL
Ga0325414_100173443300032741LeafMVEQTYQEMLSTVINELLRSLLAVLTSYVVLHKQLYRTRLTSKRRSL
Ga0325414_1004401143300032741LeafMVERTYHKVLSAIVNELLHPLLAVLTPHMRLNKQLH
Ga0325414_101698623300032741LeafMVEQIYHEMLSMVINELLRPILAVLTPSVRLHKQLHRARLTSKRRSL
Ga0325414_101997013300032741LeafMVEQTYHEMLSMVINELLRPLLAVLTSHVRLHKQLHRARLTSKRHSL
Ga0325402_102563343300033160XylemMVEQTYHEMLSTVINKLLHPLLAVLTPHVRLHKQLHQVQLTSKKRSL
Ga0307507_1004829633300033179EctomycorrhizaMVEQTYHKVLSTVVNELLRPLLAVLTSHVCLNKQLHRARLTSKRRSL
Ga0307507_1005151213300033179EctomycorrhizaMVEQTYHEVLSTVVNELLRPLLAVLTPHVRLRKQLHRAQLTSKR
Ga0307507_1006320123300033179EctomycorrhizaMIERTYHEVLSTVVHELLYPLLAVLTPHVRLYKQLYWARLTSKRRSL
Ga0307507_1009077733300033179EctomycorrhizaMVEQTYHEVLSTVVNKLLCPLLAVLTPHVRLHKQLHRAQLTSKRRIL
Ga0307507_1019245133300033179EctomycorrhizaMVEQTYHEMLRMVINELLRPLLAVLTPYVRLYKQLHRARLMSKRRSL
Ga0307507_1020948733300033179EctomycorrhizaMFEQTYHKVLSAVVNELFHPLLAVLTPYVRLNKQLHWAQLTSKRRSL
Ga0307507_1020999123300033179EctomycorrhizaMVEQTYHKILSTVVNELLRPLLAVLTLHVRLHKQLHRARLTSKRRSL
Ga0307507_1023035923300033179EctomycorrhizaMVEQTYHKVLSTVVNELLRLLFAVLTPHVRLNKQLHWARLMSKRRSL
Ga0307507_1028107023300033179EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRRL
Ga0307507_1039734613300033179EctomycorrhizaMVEQTYHEMLSMIINELLRPLLAVLTPHMRLHKQLHRARLTFKRSSL
Ga0307507_1041029323300033179EctomycorrhizaMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQLHRARLTS
Ga0307507_1042791413300033179EctomycorrhizaMVEQTYHEMLSTVINELLRPLLTVLTPHVGLHKQLHRARLTSKRRNL
Ga0307507_1043464923300033179EctomycorrhizaMVEQTYHKVLSTVVNELLRPLLAVLTPHVRLHKQLHRAWLTSN
Ga0307507_1045787613300033179EctomycorrhizaMVERTYHKVLSAIVNELLHPLLTVLTPHVRLYKQLHWARLMSKKRSL
Ga0307507_1049572213300033179EctomycorrhizaMVKRTYHKVLNAVVNELLHPLLAVLTLHVRLNKQLHWARLMSKRRSL
Ga0307507_1056694913300033179EctomycorrhizaMVEQTYHEMLSTVINELLCPLLAVLTPHVRLHKQLNRARLTSKRRSL
Ga0307507_1057647113300033179EctomycorrhizaMVEQTYHKVLSAVVNELLHPILALLTPHVHLNKQLHWAWLTSKRRRL
Ga0307510_1001636983300033180EctomycorrhizaMVEQTYHKVLSTVVNELLRPLLAVLTPHVRLHKQLHRAWLTSNRRSL
Ga0307510_1008553123300033180EctomycorrhizaMIERTYHKMLSTVVHELLHPLLAVLTAHMRLYKQLHWARL
Ga0307510_1013881713300033180EctomycorrhizaMVEQTYHEVLSTVVNELLRPFLVVLTPHVRLHKQLHRARLTSKRRSL
Ga0307510_1017071813300033180EctomycorrhizaMVERHKVLSEVVNKLLHPFLAVITPHMRLYKQLHWARLMSKRRSL
Ga0307510_1019489413300033180EctomycorrhizaMIERTYHKVLRTVVHELLHPLLVVLTPHVRLYKQLH
Ga0307510_1020272133300033180EctomycorrhizaMVEQTYHKVLSTVVNELLRPFLAVLTPNVRLNKQLHRARLTS
Ga0307510_1024238113300033180EctomycorrhizaMVEQTYHKMLSTAINELLRPLLAVLTPHVCLHKQLHRARLTSKRHSL
Ga0307510_1042709013300033180EctomycorrhizaMVEQTYHEVLSTVINELLRPLLAVLTPNVRLHKQFHRARLTSKRRSL
Ga0307510_1043782213300033180EctomycorrhizaMVEQTYHEVLSTVVNELLRPFLAVLTPHVRLHKQLYQARLT
Ga0307510_1048111413300033180EctomycorrhizaMVERTYHEVLSTVVNELLHLLLAVLTLHVRLYKQLQWAWL
Ga0307510_1051130813300033180EctomycorrhizaNNLQNKMVEQTYHEVLSTVVNELLRPLLAVLTPHVRLHKQLYRARLTSKRRSL
Ga0307510_1057946113300033180EctomycorrhizaMVEQTYHEILSIFVNELLRPLLAVLTPHVRLHKQLHRARLMSKRRSL
Ga0307510_1063391913300033180EctomycorrhizaMVEQTYHEILSTVINELLRPLLAVLTPHVRLHKQLHRARLTSKRRGL
Ga0325419_013579_6202_63453300034389LeafMVEQTYYEILSTVINELLRPVLAVLTPHMRLHKQLHQARLTSKRRSL
Ga0325419_046605_1051_11943300034389LeafMVEQIYHEMLSTVINELLRPLLVVLTPHMRLHKQLHRARLTSKRRSL
Ga0325419_053080_1321_14643300034389LeafMVEQTYHEMLSTVINELLRSLLAVLTPHVRLHKQLQQARLTSKRRSL
Ga0325419_111213_528_6713300034389LeafMVEQTYHEMLSTVINELLRPLLAVLTPHMRLHKQLHRARLTSKRCSL
Ga0325420_020041_1254_13973300034688LeafMVEQTYHEMLSTVINELLRPLLAVLTPYMRLHKQLHRARLTSKRRSL
Ga0325420_022368_3445_35883300034688LeafMVEQTYHEMLSTVINELLRPLLVVLTPYVRLHKQLHQARLTSKRRSL
Ga0325420_036465_464_6073300034688LeafMVEQIYREMLSTVVNELLLPLLAVLTPHMRLHKQLYQARLTSKRRSL
Ga0325420_037205_2861_30043300034688LeafMVEQTYHEVLSTVVNELLRPLLAVLTPHVRLHKQLHQARLTSKRRSL
Ga0325420_061235_730_8733300034688LeafMVEQTYREVLGMVVNELLCLLLAVLTPHVRLHEQLHQARLMSKRRSL
Ga0325420_100576_697_8403300034688LeafMVEQTYDEMLSMVINELLRPLLAVLTPHMGLHKQLHRARLTSKRRSL
Ga0325421_011641_6575_67183300034689LeafMVEQTYHKVLSTVVNELLRPLLAVLTPHVRLHKQLHRARLTSKRRSL
Ga0325421_026569_588_7313300034689LeafMVEQTYHKMLSTVINELLRSLLAVLTPYVHLHKQLHRARLTSKRRSL
Ga0325421_050006_1_1053300034689LeafMVEQTYHEMLSTVINELLRPLLAVLTPHVRLHKQL
Ga0325421_075557_647_7903300034689LeafMVEQTYHEMLSTVINELLRPLLAVLTPHMRLHKQLHQAQLTSKRRSL
Ga0325421_076297_203_3463300034689LeafMVEQIYHEMLSTVINELLRPLLVVLTPHMCLHKQLHRARLTSKRRSL
Ga0325421_089205_583_7263300034689LeafMVEQTYYEMLSTVINELLHPLLAVLTPHMRLHKQLHQARLTFKRRSL
Ga0325421_092738_434_5773300034689LeafMVEQTYHKMLSTVINELLRPLLAVLTPHMRLHKQLHRARLTSKRRSL
Ga0325423_009563_9210_93533300034778LeafMVEQTYHEMASTVINELLRPLLAVLTPHVHLHKQLHWARLTSKRHSL
Ga0325423_011592_7610_77533300034778LeafMVEQTYHEMLSTVINKLLHPLLAVLTPHVRLHKQLHRARLTSKSRSL
Ga0325423_053732_1423_15663300034778LeafMVEQTYHEMLSTVINELLRPLLAVLTSHVRLHKQLYRARLTSKRPSL
Ga0325407_011144_8514_86573300034899XylemMVEQTYHEMLSMVINELLRPLLAVLTPHMRLHKQLHRARLTSKRRSL
Ga0325407_048423_2154_22973300034899XylemMVEQIYREMLSTVVNELLLPLLAVLTPHMRLHKQLHQARLTSKRRSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.