NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F007447

Metagenome / Metatranscriptome Family F007447

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F007447
Family Type Metagenome / Metatranscriptome
Number of Sequences 351
Average Sequence Length 42 residues
Representative Sequence VLEGPNSPHAKSLFEFARKVVARVDEIKASAPEGVIQIQ
Number of Associated Samples 287
Number of Associated Scaffolds 351

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.17 %
% of genes near scaffold ends (potentially truncated) 95.73 %
% of genes from short scaffolds (< 2000 bps) 85.19 %
Associated GOLD sequencing projects 261
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.761 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(8.262 % of family members)
Environment Ontology (ENVO) Unclassified
(21.937 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.444 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.33%    β-sheet: 0.00%    Coil/Unstructured: 65.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 351 Family Scaffolds
PF01266DAO 41.31
PF01628HrcA 5.98
PF01391Collagen 3.42
PF13561adh_short_C2 1.71
PF10609ParA 1.71
PF05050Methyltransf_21 1.14
PF01850PIN 1.14
PF03869Arc 1.14
PF03444HrcA_DNA-bdg 0.85
PF00877NLPC_P60 0.85
PF01025GrpE 0.85
PF02163Peptidase_M50 0.57
PF09471Peptidase_M64 0.57
PF00069Pkinase 0.57
PF01979Amidohydro_1 0.57
PF01833TIG 0.28
PF02190LON_substr_bdg 0.28
PF01479S4 0.28
PF06751EutB 0.28
PF00684DnaJ_CXXCXGXG 0.28
PF09286Pro-kuma_activ 0.28
PF12969DUF3857 0.28
PF12762DDE_Tnp_IS1595 0.28
PF02518HATPase_c 0.28
PF13502AsmA_2 0.28
PF00291PALP 0.28
PF07690MFS_1 0.28
PF00254FKBP_C 0.28
PF02367TsaE 0.28
PF05685Uma2 0.28
PF00885DMRL_synthase 0.28
PF02803Thiolase_C 0.28
PF13361UvrD_C 0.28
PF00801PKD 0.28
PF03992ABM 0.28
PF00266Aminotran_5 0.28
PF01556DnaJ_C 0.28
PF11319VasI 0.28
PF07992Pyr_redox_2 0.28
PF01156IU_nuc_hydro 0.28
PF04542Sigma70_r2 0.28
PF01569PAP2 0.28
PF02538Hydantoinase_B 0.28
PF05016ParE_toxin 0.28
PF04299FMN_bind_2 0.28
PF00106adh_short 0.28

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 351 Family Scaffolds
COG1420Transcriptional regulator of heat shock responseTranscription [K] 5.98
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.28
COG0576Molecular chaperone GrpE (heat shock protein HSP-70)Posttranslational modification, protein turnover, chaperones [O] 0.85
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 0.85
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.85
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 0.57
COG0484DnaJ-class molecular chaperone with C-terminal Zn finger domainPosttranslational modification, protein turnover, chaperones [O] 0.57
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.28
COG00546,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)Coenzyme transport and metabolism [H] 0.28
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 0.28
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.28
COG4303Ethanolamine ammonia-lyase, large subunitAmino acid transport and metabolism [E] 0.28
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 0.28
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.28
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.28
COG0802tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaETranslation, ribosomal structure and biogenesis [J] 0.28
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.28
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.28


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.05 %
UnclassifiedrootN/A15.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ01DTBQ0All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104879398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300001108|JGI12647J13326_104163All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300001471|JGI12712J15308_10057927All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300001593|JGI12635J15846_10792472All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300002568|C688J35102_119367314All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300002917|JGI25616J43925_10144944All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300004091|Ga0062387_100281675All Organisms → cellular organisms → Bacteria → Acidobacteria1059Open in IMG/M
3300004092|Ga0062389_104754725All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300004114|Ga0062593_103002096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae540Open in IMG/M
3300004152|Ga0062386_100023229Not Available4551Open in IMG/M
3300004152|Ga0062386_100953791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 13_1_40CM_3_65_7710Open in IMG/M
3300004156|Ga0062589_100365734All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300004479|Ga0062595_100014792All Organisms → cellular organisms → Bacteria → Acidobacteria2732Open in IMG/M
3300005167|Ga0066672_10493926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae795Open in IMG/M
3300005332|Ga0066388_104137234Not Available740Open in IMG/M
3300005332|Ga0066388_104680572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae696Open in IMG/M
3300005334|Ga0068869_100827697All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300005344|Ga0070661_100329701All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300005435|Ga0070714_100940949All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter840Open in IMG/M
3300005435|Ga0070714_101930126All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300005436|Ga0070713_100767951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae923Open in IMG/M
3300005436|Ga0070713_101884564All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300005439|Ga0070711_100379268All Organisms → cellular organisms → Bacteria → Acidobacteria1143Open in IMG/M
3300005439|Ga0070711_100999845All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300005450|Ga0066682_10815867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae562Open in IMG/M
3300005454|Ga0066687_10037182All Organisms → cellular organisms → Bacteria2190Open in IMG/M
3300005467|Ga0070706_102083395All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae513Open in IMG/M
3300005468|Ga0070707_101437474All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300005533|Ga0070734_10404151All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300005533|Ga0070734_10644299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter603Open in IMG/M
3300005534|Ga0070735_10560829All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005541|Ga0070733_10013957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5046Open in IMG/M
3300005541|Ga0070733_10280473All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300005541|Ga0070733_10506293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae808Open in IMG/M
3300005542|Ga0070732_10219233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1138Open in IMG/M
3300005542|Ga0070732_10264765All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300005542|Ga0070732_10548077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300005546|Ga0070696_100062440All Organisms → cellular organisms → Bacteria2607Open in IMG/M
3300005547|Ga0070693_100107762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1708Open in IMG/M
3300005549|Ga0070704_102241737All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005554|Ga0066661_10713202All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae588Open in IMG/M
3300005560|Ga0066670_10542431Not Available712Open in IMG/M
3300005563|Ga0068855_100798953All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300005568|Ga0066703_10086625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1821Open in IMG/M
3300005576|Ga0066708_10311698All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300005578|Ga0068854_100718975All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300005586|Ga0066691_10365135All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300005591|Ga0070761_10014719All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon4361Open in IMG/M
3300005602|Ga0070762_10820759All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005610|Ga0070763_10877658All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae533Open in IMG/M
3300005618|Ga0068864_101222026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300005712|Ga0070764_10112134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1468Open in IMG/M
3300005938|Ga0066795_10155684All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300005995|Ga0066790_10290473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter697Open in IMG/M
3300006046|Ga0066652_101489015All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300006050|Ga0075028_100521999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae696Open in IMG/M
3300006052|Ga0075029_100179718All Organisms → cellular organisms → Bacteria1313Open in IMG/M
3300006052|Ga0075029_100527521All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300006052|Ga0075029_100709763All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300006055|Ga0097691_1015943All Organisms → cellular organisms → Bacteria3440Open in IMG/M
3300006059|Ga0075017_101461545Not Available538Open in IMG/M
3300006086|Ga0075019_10158805All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300006086|Ga0075019_10767119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300006162|Ga0075030_101244792All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300006163|Ga0070715_10541926All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300006163|Ga0070715_10692233All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes608Open in IMG/M
3300006176|Ga0070765_100462446All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300006237|Ga0097621_101028821All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes771Open in IMG/M
3300006237|Ga0097621_101430129All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300006237|Ga0097621_102044207All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300006354|Ga0075021_10895694All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae576Open in IMG/M
3300006358|Ga0068871_100140233All Organisms → cellular organisms → Bacteria2055Open in IMG/M
3300006794|Ga0066658_10668630All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006797|Ga0066659_11313330Not Available603Open in IMG/M
3300006854|Ga0075425_100246792All Organisms → cellular organisms → Bacteria2054Open in IMG/M
3300006854|Ga0075425_102075958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300006914|Ga0075436_100183524All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300007076|Ga0075435_101592277All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300007265|Ga0099794_10090373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1519Open in IMG/M
3300007788|Ga0099795_10496137Not Available569Open in IMG/M
3300009038|Ga0099829_11057986All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300009090|Ga0099827_10362318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1235Open in IMG/M
3300009092|Ga0105250_10115886All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300009093|Ga0105240_12390069All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300009143|Ga0099792_11183614Not Available518Open in IMG/M
3300009523|Ga0116221_1305729Not Available688Open in IMG/M
3300009524|Ga0116225_1014030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4263Open in IMG/M
3300009524|Ga0116225_1322037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium austroafricanum689Open in IMG/M
3300009551|Ga0105238_11947984All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300009628|Ga0116125_1044064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1127Open in IMG/M
3300009630|Ga0116114_1075178All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300009634|Ga0116124_1074125Not Available978Open in IMG/M
3300009639|Ga0116122_1012956All Organisms → cellular organisms → Bacteria3110Open in IMG/M
3300009643|Ga0116110_1007153All Organisms → cellular organisms → Bacteria4875Open in IMG/M
3300009665|Ga0116135_1426700All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300009764|Ga0116134_1179961Not Available739Open in IMG/M
3300009839|Ga0116223_10535756All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300010043|Ga0126380_10758755All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300010043|Ga0126380_11908879All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300010046|Ga0126384_10305398Not Available1310Open in IMG/M
3300010046|Ga0126384_11738089All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300010048|Ga0126373_11078980All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300010159|Ga0099796_10034794All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300010326|Ga0134065_10403651All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300010341|Ga0074045_10394706Not Available898Open in IMG/M
3300010360|Ga0126372_10088253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2285Open in IMG/M
3300010361|Ga0126378_12936877All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300010375|Ga0105239_11973403All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300010376|Ga0126381_102814107All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300010376|Ga0126381_102831931All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300010376|Ga0126381_103232198All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300010398|Ga0126383_13317267Not Available526Open in IMG/M
3300010403|Ga0134123_10655248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1019Open in IMG/M
3300011120|Ga0150983_13521641All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012201|Ga0137365_11271923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis523Open in IMG/M
3300012206|Ga0137380_10996572All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300012209|Ga0137379_11479367All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300012210|Ga0137378_10973692Not Available762Open in IMG/M
3300012212|Ga0150985_122965201All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300012361|Ga0137360_10480871All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300012362|Ga0137361_10101587All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2502Open in IMG/M
3300012362|Ga0137361_11102275All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300012363|Ga0137390_10388037All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1376Open in IMG/M
3300012683|Ga0137398_10870695All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300012685|Ga0137397_10077016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2420Open in IMG/M
3300012917|Ga0137395_10426673All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes951Open in IMG/M
3300012918|Ga0137396_10125733All Organisms → cellular organisms → Bacteria → Acidobacteria1851Open in IMG/M
3300012918|Ga0137396_10173513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1577Open in IMG/M
3300012923|Ga0137359_11097886All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300012925|Ga0137419_11967929All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012927|Ga0137416_10684077All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis900Open in IMG/M
3300012930|Ga0137407_11098965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300012957|Ga0164303_11451416All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300012958|Ga0164299_11037881All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes607Open in IMG/M
3300012971|Ga0126369_10134147All Organisms → cellular organisms → Bacteria → Acidobacteria2303Open in IMG/M
3300012971|Ga0126369_12752495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae575Open in IMG/M
3300012971|Ga0126369_13238657All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300012986|Ga0164304_11122284All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300012989|Ga0164305_11174187Not Available664Open in IMG/M
3300013100|Ga0157373_10136399All Organisms → cellular organisms → Bacteria → Acidobacteria1725Open in IMG/M
3300013296|Ga0157374_10275381Not Available1660Open in IMG/M
3300013296|Ga0157374_11943325All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300013308|Ga0157375_12772146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300013308|Ga0157375_13619461All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300013308|Ga0157375_13666649All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300014150|Ga0134081_10350443Not Available542Open in IMG/M
3300014155|Ga0181524_10402113Not Available597Open in IMG/M
3300014156|Ga0181518_10147091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Neosynechococcus → Neosynechococcus sphagnicola → Neosynechococcus sphagnicola sy11266Open in IMG/M
3300014166|Ga0134079_10345522All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300014167|Ga0181528_10863908Not Available510Open in IMG/M
3300014169|Ga0181531_10666149All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300014169|Ga0181531_10760444All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300014489|Ga0182018_10102638All Organisms → cellular organisms → Bacteria1675Open in IMG/M
3300014495|Ga0182015_10048924All Organisms → cellular organisms → Bacteria → Acidobacteria3102Open in IMG/M
3300014654|Ga0181525_10433496All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300015051|Ga0137414_1167018Not Available4153Open in IMG/M
3300015372|Ga0132256_101941278All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300017823|Ga0187818_10507470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300017823|Ga0187818_10541348All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300017927|Ga0187824_10391365All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300017930|Ga0187825_10249712All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300017930|Ga0187825_10409537Not Available522Open in IMG/M
3300017934|Ga0187803_10034712All Organisms → cellular organisms → Bacteria → Acidobacteria2003Open in IMG/M
3300017936|Ga0187821_10432404All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300017937|Ga0187809_10133567All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300017943|Ga0187819_10066140All Organisms → cellular organisms → Bacteria2149Open in IMG/M
3300017943|Ga0187819_10331098All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300017946|Ga0187879_10041129All Organisms → cellular organisms → Bacteria2755Open in IMG/M
3300017959|Ga0187779_10603177All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300017972|Ga0187781_10835490All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300017972|Ga0187781_10943326All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300017974|Ga0187777_10373815All Organisms → cellular organisms → Bacteria → Acidobacteria983Open in IMG/M
3300017975|Ga0187782_10353073All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300017995|Ga0187816_10218436All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300017995|Ga0187816_10218588All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300018003|Ga0187876_1196529All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300018003|Ga0187876_1309509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis500Open in IMG/M
3300018012|Ga0187810_10332662All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300018019|Ga0187874_10089523All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300018026|Ga0187857_10358065Not Available661Open in IMG/M
3300018029|Ga0187787_10454211All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300018034|Ga0187863_10292799All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300018042|Ga0187871_10231712All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300018042|Ga0187871_10880751Not Available500Open in IMG/M
3300018047|Ga0187859_10070765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1837Open in IMG/M
3300018047|Ga0187859_10342270All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300018057|Ga0187858_10880274All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300018085|Ga0187772_10021339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3729Open in IMG/M
3300018085|Ga0187772_11005706All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300018085|Ga0187772_11264813Not Available545Open in IMG/M
3300018086|Ga0187769_10827390Not Available700Open in IMG/M
3300018086|Ga0187769_11411794All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300018088|Ga0187771_10031742All Organisms → cellular organisms → Bacteria4022Open in IMG/M
3300018090|Ga0187770_10966049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae685Open in IMG/M
3300018431|Ga0066655_11207639All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300019268|Ga0181514_1618193Not Available658Open in IMG/M
3300020006|Ga0193735_1091131All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300020021|Ga0193726_1006804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6576Open in IMG/M
3300020022|Ga0193733_1000460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis13629Open in IMG/M
3300020022|Ga0193733_1024319All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300020078|Ga0206352_11086126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1057Open in IMG/M
3300020170|Ga0179594_10220376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes713Open in IMG/M
3300020579|Ga0210407_10417467All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300020580|Ga0210403_10001160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae25578Open in IMG/M
3300020580|Ga0210403_11294405Not Available557Open in IMG/M
3300020581|Ga0210399_10001237All Organisms → cellular organisms → Bacteria → Acidobacteria20035Open in IMG/M
3300020581|Ga0210399_11040727All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300020582|Ga0210395_11284395All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300021168|Ga0210406_10149115All Organisms → cellular organisms → Bacteria → Acidobacteria1964Open in IMG/M
3300021168|Ga0210406_11393940Not Available501Open in IMG/M
3300021171|Ga0210405_10999551All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300021178|Ga0210408_10142692All Organisms → cellular organisms → Bacteria1895Open in IMG/M
3300021402|Ga0210385_11556736Not Available505Open in IMG/M
3300021403|Ga0210397_10746982All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300021404|Ga0210389_10142592All Organisms → cellular organisms → Bacteria1856Open in IMG/M
3300021404|Ga0210389_10801719All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300021405|Ga0210387_11323523All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300021407|Ga0210383_11555793All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300021420|Ga0210394_11070566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300021432|Ga0210384_10799010All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300021432|Ga0210384_11854403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300021478|Ga0210402_11859734Not Available528Open in IMG/M
3300024055|Ga0247794_10321629All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300025134|Ga0207416_1133767All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300025612|Ga0208691_1036218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1133Open in IMG/M
3300025900|Ga0207710_10150855All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300025905|Ga0207685_10388790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes712Open in IMG/M
3300025906|Ga0207699_10074370All Organisms → cellular organisms → Bacteria → Acidobacteria2087Open in IMG/M
3300025909|Ga0207705_11252675All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300025910|Ga0207684_11639519All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300025913|Ga0207695_11487410All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300025914|Ga0207671_10921277All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300025915|Ga0207693_11185345All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300025920|Ga0207649_10019789All Organisms → cellular organisms → Bacteria3852Open in IMG/M
3300025922|Ga0207646_10321379Not Available1398Open in IMG/M
3300025924|Ga0207694_10716000All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300025928|Ga0207700_11837774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300025929|Ga0207664_10787190All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300025929|Ga0207664_11445814All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300025929|Ga0207664_11574665All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300025949|Ga0207667_10695344All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300026067|Ga0207678_10362007All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300026277|Ga0209350_1087381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium813Open in IMG/M
3300026318|Ga0209471_1195927All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300026335|Ga0209804_1216601All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300026354|Ga0257180_1035029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300026489|Ga0257160_1049381All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300026529|Ga0209806_1185067All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300026552|Ga0209577_10250763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1336Open in IMG/M
3300027432|Ga0209421_1112355All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300027497|Ga0208199_1060130All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300027548|Ga0209523_1111108All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300027591|Ga0209733_1032232Not Available1408Open in IMG/M
3300027610|Ga0209528_1063959All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300027652|Ga0209007_1009549All Organisms → cellular organisms → Bacteria2573Open in IMG/M
3300027660|Ga0209736_1073818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium944Open in IMG/M
3300027660|Ga0209736_1197691Not Available522Open in IMG/M
3300027727|Ga0209328_10238885Not Available544Open in IMG/M
3300027745|Ga0209908_10019039All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300027765|Ga0209073_10449899All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300027773|Ga0209810_1153308All Organisms → cellular organisms → Bacteria → Acidobacteria959Open in IMG/M
3300027812|Ga0209656_10047795All Organisms → cellular organisms → Bacteria2436Open in IMG/M
3300027825|Ga0209039_10012592Not Available4726Open in IMG/M
3300027853|Ga0209274_10070476All Organisms → cellular organisms → Bacteria1688Open in IMG/M
3300027853|Ga0209274_10598975All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300027854|Ga0209517_10046393All Organisms → cellular organisms → Bacteria3343Open in IMG/M
3300027854|Ga0209517_10100957All Organisms → cellular organisms → Bacteria1945Open in IMG/M
3300027862|Ga0209701_10066087All Organisms → cellular organisms → Bacteria2295Open in IMG/M
3300027867|Ga0209167_10025045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2849Open in IMG/M
3300027869|Ga0209579_10177848All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300027869|Ga0209579_10657806Not Available568Open in IMG/M
3300027875|Ga0209283_10747132All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300027882|Ga0209590_10002870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7002Open in IMG/M
3300027884|Ga0209275_10110087All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300027884|Ga0209275_10234212All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300027894|Ga0209068_10513317All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300027903|Ga0209488_10473101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae921Open in IMG/M
3300027911|Ga0209698_10068043All Organisms → cellular organisms → Bacteria3053Open in IMG/M
3300028023|Ga0265357_1030392All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300028380|Ga0268265_10450688All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300028734|Ga0302206_1143603Not Available595Open in IMG/M
3300028745|Ga0302267_10389150Not Available577Open in IMG/M
3300028798|Ga0302222_10001792All Organisms → cellular organisms → Bacteria → Acidobacteria10534Open in IMG/M
3300028868|Ga0302163_10248013Not Available506Open in IMG/M
3300028906|Ga0308309_11788078All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300029636|Ga0222749_10059460All Organisms → cellular organisms → Bacteria1709Open in IMG/M
3300029908|Ga0311341_10032296All Organisms → cellular organisms → Bacteria4364Open in IMG/M
3300029951|Ga0311371_11102202All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300029956|Ga0302150_10350658All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300030007|Ga0311338_11154415All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola738Open in IMG/M
3300030042|Ga0302300_1227382All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300030051|Ga0302195_10090703All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300030659|Ga0316363_10394516All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300030706|Ga0310039_10041183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2083Open in IMG/M
3300030730|Ga0307482_1030428All Organisms → cellular organisms → Bacteria → Acidobacteria1199Open in IMG/M
3300030815|Ga0265746_1004270All Organisms → cellular organisms → Bacteria → Acidobacteria1456Open in IMG/M
3300031057|Ga0170834_102681534All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300031057|Ga0170834_105269203All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300031231|Ga0170824_105915956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300031231|Ga0170824_108759409Not Available1101Open in IMG/M
3300031233|Ga0302307_10107902Not Available1455Open in IMG/M
3300031241|Ga0265325_10130590All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300031344|Ga0265316_10090450All Organisms → cellular organisms → Bacteria2335Open in IMG/M
3300031446|Ga0170820_10120939All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300031524|Ga0302320_10933095Not Available933Open in IMG/M
3300031525|Ga0302326_12057115All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300031561|Ga0318528_10655488All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300031708|Ga0310686_104351471All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300031708|Ga0310686_109377511Not Available1192Open in IMG/M
3300031720|Ga0307469_11067920All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300031720|Ga0307469_11159201All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300031736|Ga0318501_10579022All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300031740|Ga0307468_100163591All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300031754|Ga0307475_10998789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300031893|Ga0318536_10570133All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031896|Ga0318551_10799462All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031910|Ga0306923_10187517All Organisms → cellular organisms → Bacteria → Acidobacteria2363Open in IMG/M
3300031912|Ga0306921_10308842All Organisms → cellular organisms → Bacteria → Acidobacteria1851Open in IMG/M
3300031954|Ga0306926_11215345All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300031962|Ga0307479_10488291Not Available1215Open in IMG/M
3300031962|Ga0307479_10809631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium912Open in IMG/M
3300031962|Ga0307479_11006325All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300032066|Ga0318514_10722846All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300032180|Ga0307471_102954231Not Available603Open in IMG/M
3300032205|Ga0307472_101122816All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300032205|Ga0307472_102265635All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300032515|Ga0348332_14380581All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter969Open in IMG/M
3300032782|Ga0335082_11071624All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae671Open in IMG/M
3300032783|Ga0335079_11389796All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300032783|Ga0335079_12110868Not Available540Open in IMG/M
3300032805|Ga0335078_12407269All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300032828|Ga0335080_11728607All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300032829|Ga0335070_10510764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1138Open in IMG/M
3300032892|Ga0335081_10066479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5545Open in IMG/M
3300032892|Ga0335081_10290750All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300032955|Ga0335076_11268396Not Available621Open in IMG/M
3300033004|Ga0335084_10676311All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300033158|Ga0335077_11443602All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300033433|Ga0326726_10333331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1429Open in IMG/M
3300033433|Ga0326726_11759214Not Available604Open in IMG/M
3300033808|Ga0314867_119091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae616Open in IMG/M
3300034282|Ga0370492_0037815All Organisms → cellular organisms → Bacteria → Acidobacteria1984Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.99%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.70%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.70%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.42%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.13%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.13%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.13%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.28%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.85%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.71%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.71%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.42%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.14%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.14%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.14%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.14%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.57%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.57%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.57%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.57%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.28%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.28%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.28%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.28%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.28%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.28%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.28%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.28%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.28%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.28%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.28%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.28%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.28%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.28%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.28%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.28%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001108Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028734Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_1EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033808Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_082293902170459024Grass SoilEAGDSGSPAVLKDVDSPSVKSLYDFARKVVARVTEVKSHAPESVIQIQ
INPhiseqgaiiFebDRAFT_10487939823300000364SoilEESPHAKALFEFARQVXXRVEEIKSQAPEGVIQIQ*
JGI12647J13326_10416323300001108Forest SoilPSVLQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ*
JGI12712J15308_1005792713300001471Forest SoilEIRKSGDSGSPSVLEGENSSHAKSLFAFARNVATRVDELKASSSESVIQIQ*
JGI12635J15846_1079247223300001593Forest SoilLEGENSPHAKSIYEFAKNVATRTAEIRANAPASVIQIQ*
C688J35102_11936731423300002568SoilNGKPSVLDGEGSTRGKSLYDFARNVVARVKEVKANAGEGVIQIQ*
JGI25616J43925_1014494413300002917Grasslands SoilEIRKSGDSGSPSVLQGEDSPHAKSLFAXARXVXARVEEIKATSPESVIQIQ*
soilH1_1007901123300003321Sugarcane Root And Bulk SoilRASDSGSPTVLEGTDSAHAKSLYDFAKKVVSRVDEIEASAPQGVIQIQ*
Ga0062387_10028167523300004091Bog Forest SoilPTVLEGPNSPHAKSLFDFARKVVARVDEIKANATEGVIQIQ*
Ga0062389_10475472513300004092Bog Forest SoilTVLEGEDSPHAKSLFAFARNVVARVEEIKANSPESVIQIQ*
Ga0062593_10300209623300004114SoilGKPIVIQGEDSSHAKSIYEFARRVAARVDEIKAAAPQDVIQIQ*
Ga0062386_10002322913300004152Bog Forest SoilSGTPSVLQGEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ*
Ga0062386_10095379123300004152Bog Forest SoilSGTPSVLQGEDSPHAKSLFAFARNVAARVDEIKAGSSESVIQIQ*
Ga0062589_10036573413300004156SoilDIRKASDSGQPTVLAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ*
Ga0062595_10001479213300004479SoilDPEIRRAGDEGKPTVLEGENSAQAKPLFDFARKVVERVGQIRSSAGEGVIQIQ*
Ga0066672_1049392613300005167SoilGQPAVLAGEDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ*
Ga0066388_10413723423300005332Tropical Forest SoilGQPVVLAGEDAEQAKSLYEFARKVAARVEEIEANAAESVIHIQ*
Ga0066388_10468057213300005332Tropical Forest SoilGQPPVLEGENSPAAKSLYDFARKVIARVEEIKSTASAGVIQIQ*
Ga0068869_10082769713300005334Miscanthus RhizosphereVLEGENSPHAKALFDFARKVVERVGQIRANAGEGVIHIQ*
Ga0070661_10032970113300005344Corn RhizospherePAVLAGEDSPHAKSLYALARKVETRVSEIKAAAPEGVIQIQ*
Ga0070714_10094094913300005435Agricultural SoilAVLEGESSPHAKALFDFAHRVEERIEQIKAAAPEGVIQIQ*
Ga0070714_10193012613300005435Agricultural SoilEGKPAVLEGENSPHAKALFDFAHRVVERVEQIKSAAPESVIQIQ*
Ga0070713_10076795113300005436Corn, Switchgrass And Miscanthus RhizosphereIRRSGDQGKPAVLEGEDSVHATPLFDFARKVAERVQQIRSSAPEGVIQIQ*
Ga0070713_10188456413300005436Corn, Switchgrass And Miscanthus RhizospherePAVLEGEGSSHAKALFEFARKVAERVKQIRSSAPEGVIQIQ*
Ga0070711_10037926813300005439Corn, Switchgrass And Miscanthus RhizospherePDIRKAGDTGKPAVLEGENSPHAKSLFAFARSVESRITEIKANAPESVIQIQ*
Ga0070711_10099984523300005439Corn, Switchgrass And Miscanthus RhizosphereTGKPVVLEGENGAHAKSLYEFAHRVVDRVNEIKSKATENVIQIQ*
Ga0066682_1081586723300005450SoilAVLAGEDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ*
Ga0066687_1003718213300005454SoilPMVLAGESSAPSKSLYQFARNVVTRVDEIKSTAGESVIQIQ*
Ga0070706_10208339523300005467Corn, Switchgrass And Miscanthus RhizosphereGDSGSPSVLQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ*
Ga0070707_10143747423300005468Corn, Switchgrass And Miscanthus RhizosphereVLEGENSPHAKALFDFARRVVERVEQIKSAAPESVIQIQ*
Ga0070734_1040415113300005533Surface SoilGENSPHAKSIYEFANRVRARIDEIRANAPAGVIQIQ*
Ga0070734_1064429913300005533Surface SoilDEGRPAVLEDESSPHAKSLFDFAHRVEERIEQIKSAAPEGVIQIQ*
Ga0070735_1056082913300005534Surface SoilVLEGENSAHAKSLFEFARNVVTRVSEIKSTTGDSVIQIQ*
Ga0070733_1001395763300005541Surface SoilLEGEDSPHAKGLFDFARRVVQRTDEIKSQASEGVIQIQ*
Ga0070733_1028047313300005541Surface SoilSGDSGKPTVLEGEGSAHAKSLFDFARKVIARVDELKATAGESVIQIQ*
Ga0070733_1050629323300005541Surface SoilGQPVVLRGENSAPSKSLFDFARKVVARVSEIRAAAPADVIQIQ*
Ga0070732_1021923313300005542Surface SoilNSPHAKSIYEFARKVIERVGEIKANAPGNVIQIQ*
Ga0070732_1026476513300005542Surface SoilNSPHAKAIYEFAHKVIDRVTEIKANAPANVIQIQ*
Ga0070732_1054807713300005542Surface SoilENSPHAKSIYEFAQRVTARTAEIKANAPASVIQIQ*
Ga0070672_10025325833300005543Miscanthus RhizosphereTVLEGTESAHAKSLYDFTRRVVSRVDEIEAAAPQGVIQIQ*
Ga0070696_10006244013300005546Corn, Switchgrass And Miscanthus RhizosphereIRKASDSGRPTVLGGEASSSGKSLYDFARKVVTRVDEIKANAGESVIQIQ*
Ga0070693_10010776233300005547Corn, Switchgrass And Miscanthus RhizosphereVLEGENSPHAKPLFDFARKVAERVGQIRSSAGEGVIQIQ*
Ga0070704_10224173713300005549Corn, Switchgrass And Miscanthus RhizosphereKASDSGQPTVLAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ*
Ga0066661_1071320223300005554SoilAVLAGEDAAHAKSLYEFARKVAARVDEIKSGAAESVIHIQ*
Ga0066670_1054243113300005560SoilAVLEGEESPHAKALFEFARQVVGRVEEIRAQAPESVIQIQ*
Ga0068855_10079895323300005563Corn RhizosphereNSPHAKSIYEFARKVIDRVGEIKANAPAGVIQIQ*
Ga0066703_1008662533300005568SoilVLEGEVSPSAQSLFEFARRVIARVAEIKAGESEGVIHVQ*
Ga0066708_1031169823300005576SoilRKSGDEGKPAVLEGEDSPHAKALFDFARHVVERVDQIKSAAPEGVVQIQ*
Ga0068854_10071897513300005578Corn RhizosphereVLAGEDSPHAKSLYALARKVEVRIAEIKSAAPEGVIQIQ*
Ga0066691_1036513533300005586SoilGGTPAVLKGEDSPHAKSLFAVARKVAARVDEIKAGSSESVIQIQ*
Ga0070761_1001471913300005591SoilPEIRKSGDGGVPAVLQGEDSPHAKSLFAFARNVAARVDKIKASSSESVIQIQ*
Ga0070762_1082075923300005602SoilLQGEDSPHAKSLFAFARNVVTRVDELKASSSESVIQIQ*
Ga0070763_1087765813300005610SoilEGENSPHAKSIYEFAQKVAARTAEIRASAPASVIQIQ*
Ga0068864_10122202623300005618Switchgrass RhizosphereDSGKPTVLDGEGSPHAKSLFDFARKVETRVKEINAAAPESVIQIQ*
Ga0070764_1011213413300005712SoilEIGRGGDNGSPAVLKGESSSHAKSLFEFARKVVARVEEIKATTSENVIQIQ*
Ga0068858_10022681713300005842Switchgrass RhizosphereDSGTPTVLEGENSAHAKSLYDFANKVVTRVDEIEANAPRGVIQIQ*
Ga0075285_102750423300005890Rice Paddy SoilTGKPAVLEGEASAHAKSLYAFARNVETRVKEIKAAAPDNVIQIQ*
Ga0066795_1015568423300005938SoilDSPHAKSLFAFARNVAARVEEIRAGSSESVIQIQ*
Ga0066790_1029047323300005995SoilLNGEDSAHAKSLYAFARKVASRIDEIKASAPESVIQIQ*
Ga0066652_10148901523300006046SoilVLEGEASSHAKALFDFAKKVDERVQHIRSSAPEGVIQIQ*
Ga0075028_10052199923300006050WatershedsESSSHAKSLFEFARNVIARVDEIKSNAGQSVIQIQ*
Ga0075029_10017971843300006052WatershedsSGSPAVLMGEDSPHAKSLFEFARKVVARVEEIKSSSSEGVIQIQ*
Ga0075029_10052752113300006052WatershedsIVLEGESSPHAKSIYDFARRVVDRVGEIKASAPGNVIQIQ*
Ga0075029_10070976313300006052WatershedsGDTGKPAVLKGENSPYAKSLYDFARKVEARVQEINASASESVIQIQ*
Ga0097691_101594363300006055Arctic Peat SoilEIRKSGDSGDPAVLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ*
Ga0075017_10146154513300006059WatershedsEIRRSGDSGSPAVLKGEDSPHAKSLFEFARKVAARVEEIKASSSEGVIQIQ*
Ga0075019_1015880533300006086WatershedsAVLKGEDSPHAKSLFEFARRVAVRVEEIKSSSSEGVIQIQ*
Ga0075019_1076711923300006086WatershedsGGKPAVLAGEDSAHGKSLFAFARKVAARVEEIKASAPGNVVQIQ*
Ga0075030_10124479223300006162WatershedsLEGENSPHAKSIYEFARRVVDRVAEIKASAPANVIQIQ*
Ga0070715_1054192623300006163Corn, Switchgrass And Miscanthus RhizosphereAVLEGESSGHAKPLFDFARQVAQRVEEIKSSAPEGVIQIQ*
Ga0070715_1069223313300006163Corn, Switchgrass And Miscanthus RhizosphereAGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ*
Ga0070765_10046244613300006176SoilPNIRKAGDSGKPTALEGEGSAQAKSLYDFARNVIARVDEIKSHAGESVIQIQ*
Ga0097621_10102882113300006237Miscanthus RhizosphereIRKASDSGRPTVLAGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ*
Ga0097621_10143012923300006237Miscanthus RhizosphereTPVVLEGENSPHAKSIYEFAKNVAARTAEIKANAPASVIQIQ*
Ga0097621_10204420723300006237Miscanthus RhizosphereGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ*
Ga0075021_1089569423300006354WatershedsTVLEGEGSPHAKSLYEFARKVIARVDEIKSSAGESVIQIQ*
Ga0068871_10014023343300006358Miscanthus RhizosphereVLEGEDSPHAKALFDFARRVVERVEQIKAAAPESVIQIQ*
Ga0066658_1066863013300006794SoilIQLDPQIRKSGDEGRPTVFEGESSPHAKALFDFAHRVEERIEQIKAAAPEGVIQIQ*
Ga0066659_1131333023300006797SoilESAPHAKSLFEFARRVADRIEQIKSSAPESVIQIQ*
Ga0075425_10024679233300006854Populus RhizosphereGDGGQPMVLAGEDFAPAKSLYEFARKVVARVDEIKSTAGESVIQIQ*
Ga0075425_10207595813300006854Populus RhizosphereQPIVLEGQDAAHAKSLYQFARKVVARVNEITSSAAESVIHIQ*
Ga0075436_10018352423300006914Populus RhizosphereRKASDSGRPTVLGGEVSSSGKSLYDFARKVVTRVDEIKANAGESVIQIQ*
Ga0075435_10159227723300007076Populus RhizosphereDFAPAKSLYEFARKVVARVDEIKSTAGESVIQIQ*
Ga0099794_1009037313300007265Vadose Zone SoilENSPSAQSLYEFARKVIARVTEIKAGESEGVIHVQ*
Ga0099795_1049613713300007788Vadose Zone SoilEIRKAGDSGSPAVLQGEDSPHAKSLFEFARKVVERVDKIKASSTASVVQIQ*
Ga0099829_1105798613300009038Vadose Zone SoilLDPEVRKSGDGGKPVVLEGENSAHAKSLFAFARKVEARVAEIRATAPESVIQIH*
Ga0099827_1036231813300009090Vadose Zone SoilDSPSAQSLYEFARKVIARVTEIKAGESEGVIHVQ*
Ga0105250_1011588623300009092Switchgrass RhizosphereVLGGEVSSSGKSLYDFARKVVTRVDEIKANAGERVIQIQ*
Ga0105240_1239006923300009093Corn RhizosphereGEDSPHAKSLYALARKVEVRIAEIKSAAPEGVIQIQ*
Ga0099792_1118361413300009143Vadose Zone SoilGGEDSPHAKSIFAFARKVAARVVEIKAGESASVIQIQ*
Ga0116221_130572923300009523Peatlands SoilRKSGDGGTPAVLQGEDSPSAKSLFAFARNVAARVEEIKAGSSESVIQIQ*
Ga0116225_101403043300009524Peatlands SoilPSVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ*
Ga0116225_132203733300009524Peatlands SoilKPSVLEGENSPHAKSLYEFARKVVARVSEIKANAPESVIQIQ*
Ga0105238_1194798413300009551Corn RhizospherePEIRRSGDEGKPAVLEGENSPHAKALFDFARKVVERVGQIRANAGEGVIHIQ*
Ga0116125_104406433300009628PeatlandVVLEGENSPHAKSIYEFAHRVAARVAEIKAGEGAGVISIQ*
Ga0116114_107517813300009630PeatlandSGDGGSPAVLQGENSAHAKSLFAFARNVVARVDEIKASSSQSVIQIQ*
Ga0116124_107412513300009634PeatlandDSPHAKSLFAFARNVVARVEEIKAGSSDSVIQIQ*
Ga0116122_101295643300009639PeatlandAVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ*
Ga0116110_100715313300009643PeatlandQGEDSPHAKSLFAFARNVVARVDEIKASSSQSVIQIQ*
Ga0116135_142670013300009665PeatlandGENSPHAKSLFAFARKVVERVSEIKANSSESVIQIQ*
Ga0116134_117996113300009764PeatlandGDGGSPSVLQGEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ*
Ga0116223_1053575623300009839Peatlands SoilALRQAGDTGKAVVLDGENSPAAKSLYEFARKVVARVDEIKAGASENVIQIQ*
Ga0126380_1075875523300010043Tropical Forest SoilGSIALDPEVRKSGDGGKPVVLEGENSPHARSIFEFARKVIDRVSEIKASAPGNVIQIQ*
Ga0126380_1190887913300010043Tropical Forest SoilEASPHAKSIYDFARKVIDRVGEIKANTPANVIQIQ*
Ga0126384_1030539823300010046Tropical Forest SoilPAVLGGEQSQHAKSLFGFAQNVESRVSEIKKSTAEGVIQIQ*
Ga0126384_1173808913300010046Tropical Forest SoilQGTPAVLEGESSAHAKPLFDFARRVAERVEQIRSAAPAGVIQIQ*
Ga0126373_1107898013300010048Tropical Forest SoilPVVLEGENSSHARSIFEFARKVIDRVSEIKASAPGNVIQIQ*
Ga0099796_1003479413300010159Vadose Zone SoilLAGEGTASGKSLFDFARKVVVRVDEIKANTGESVIQIQ*
Ga0134065_1040365123300010326Grasslands SoilEVQLDPGIRQAGDAGQPAVLAGENTPHAKSLFEFARRVAARVDEIKSSATESVISIQ*
Ga0074045_1039470613300010341Bog Forest SoilAGDGGKPAVLQGEDSAHAKSLFEFARKVVARVEEIKANSSQGVIQIQ*
Ga0126372_1008825333300010360Tropical Forest SoilIALDPEVRKSGDGGKPVVLEGENSPHARSIYDFARRVIDRVGQIKASSPGNVIQIQ*
Ga0126378_1293687713300010361Tropical Forest SoilSSPHAKSLFEFAKQVVARVAEVKGTQTDSVIQIQ*
Ga0105239_1197340323300010375Corn RhizosphereAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ*
Ga0126381_10281410723300010376Tropical Forest SoilALDPEVRKAGDGGRPVVLEGENSPHAKSMYEFAKKVIDRVGEIKVNAPGNVIQIQ*
Ga0126381_10283193123300010376Tropical Forest SoilGDEGKPAVLAGESSPHAKPLFDFARHVAERVEQIKSTAPEGVIQIQ*
Ga0126381_10323219813300010376Tropical Forest SoilKPAVLAGESSPHAKPLFDFARHVAERVEQIKSIASEGVIQIQ*
Ga0126383_1331726713300010398Tropical Forest SoilSSPHAKSIYDFARRVIDRVGEIKANAPGSVIQIQ*
Ga0134121_1279543613300010401Terrestrial SoilSGSPTVLEGTDSAHAKSLYDFTKKVVSRVDEIEAAAPQGVIQIQ*
Ga0134123_1065524813300010403Terrestrial SoilKAGDSGKPTVLDGEGSPHAKSLFDFARKVETRVKEINAAAPESVIQIQ*
Ga0150983_1352164113300011120Forest SoilENSPHAKSIFAFARNVVARVEEIKANAGGSVIQIQ*
Ga0137365_1127192323300012201Vadose Zone SoilEIRKSGDEGRPAVLEGQSSPHAKSLFEFARRVAERVEQIRSSAPESVIQIQ*
Ga0137380_1099657223300012206Vadose Zone SoilESAPHAKSLFEFARRVVDRVEQIKSSAPESVIQIQ*
Ga0137379_1147936723300012209Vadose Zone SoilVLAGEDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ*
Ga0137378_1097369213300012210Vadose Zone SoilPAIRKAGDGGRPMVLAGEDVAAAKSLYEFARKVVTRVDEIKSTAGESVIQIH*
Ga0150985_12296520123300012212Avena Fatua RhizosphereEGESSPHAKALFDFAHRVEERIEQIKAAAPEGVIQIQ*
Ga0137360_1048087113300012361Vadose Zone SoilEVGKSVDGGKPVVLEGENSAHAKSLFAFARKVEARVAEIRATAPESVIQIQ*
Ga0137361_1010158733300012362Vadose Zone SoilGSPAVLKGEDSPHAKSLFEFARKVVARVDEVKASSSASVVQIQ*
Ga0137361_1110227513300012362Vadose Zone SoilVLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ*
Ga0137390_1038803723300012363Vadose Zone SoilKPTVLEGEESSHAKPLYEFARKVVARVEQIRASSPESVISIQ*
Ga0137398_1087069513300012683Vadose Zone SoilEIRKSGDSGSPSVLQGEDSPHAKSLFAFARNVAARVEQIKASSSESVIQIQ*
Ga0137397_1007701613300012685Vadose Zone SoilKAGDTGSPAVLKGEDSAHAKSLFEFARKVVARVDDIKASSSASVVQIQ*
Ga0137395_1042667313300012917Vadose Zone SoilLGGEGNAYGKSLFDFARTVVTRVDEIKANAGESVIQIQ*
Ga0137396_1012573313300012918Vadose Zone SoilDSGKPAVLEGENSPRAKSLYDFTRKVITRVDEIRASAPESVMQIQ*
Ga0137396_1017351323300012918Vadose Zone SoilVLQGEDSPHAKSLFEFARKVVARVDEIKASSSASVVQIQ*
Ga0137359_1109788613300012923Vadose Zone SoilEIRKSGDSGSPSVLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ*
Ga0137419_1196792923300012925Vadose Zone SoilGKPAVLEGENSPRAKSLYDFTRKVITRVDEIRASAPESVIQIQ*
Ga0137416_1068407723300012927Vadose Zone SoilPEIRKSGDQGKPAVLEGETSPHAKALFEFARRVAERVEHIKSSAPETVVQIQ*
Ga0137407_1109896513300012930Vadose Zone SoilVLKGEDSPHARSLFAFARNVVSRVDEIKASSPASVVQIQ*
Ga0164303_1145141613300012957SoilRRAGDEGKPAVLEGENSPHAKPLFDFARKVAERVGQIRSSAGEGVIQIQ*
Ga0164299_1103788123300012958SoilGRPTVLAGEGTASGKSLFDFARKVVARVDEIKANAGEAVIQIQ*
Ga0126369_1013414713300012971Tropical Forest SoilEGESSPHAKSIYDFARKVVDRVGEIKAAAPANVIQIQ*
Ga0126369_1275249523300012971Tropical Forest SoilPTALEGEGSAHAKSLYEFARNVMTRVDEIKSKAGESVIQIQ*
Ga0126369_1323865723300012971Tropical Forest SoilLEGESSPQAKSLFDFARGVVARVQEIKATAPEGVIQIQ*
Ga0164304_1112228413300012986SoilTGKPAVLDGENAPHAKALYEFARRVVARVREIRAQSGDSVIQIQ*
Ga0164305_1117418723300012989SoilEESAHAKPLFDFARQVIGRVDEIKSQAPEGVIQIQ*
Ga0157373_1013639913300013100Corn RhizosphereGENSPHAKSIYEFARKVIDRVGEIKANAPAGVIQIQ*
Ga0157374_1027538133300013296Miscanthus RhizosphereDSAHAKSIYEFARRVVNRVDEIKAAAPQDVIQIQ*
Ga0157374_1194332523300013296Miscanthus RhizosphereLEGENSPHAKPLFDFARKVAERVQQIRASAGEGVIQIQ*
Ga0157375_1277214623300013308Miscanthus RhizosphereSDSGQPTVLAGEVSSSGKSLYDFARKVVTRVDEIKANAGESVIQIQ*
Ga0157375_1361946113300013308Miscanthus RhizosphereEGKPTVLEGENSAQAKPLFDFARKVVERVGQIRSSAGEGVIQIQ*
Ga0157375_1366664913300013308Miscanthus RhizospherePDIRKASDSGQPTVLAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ*
Ga0134081_1035044313300014150Grasslands SoilVLAGESYPHAKSLFEFAKKVIFRVQEMKSSSSGTVIKVQ*
Ga0181524_1040211323300014155BogAPSVLAGEDAPHAKSLFAFARKVAARVEEIKAGNSESVIQIQ*
Ga0181518_1014709113300014156BogEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ*
Ga0134079_1034552213300014166Grasslands SoilGESSPHAKSLFDLARHVVRRVEQIKSTAPEGVVQIQ*
Ga0181528_1086390813300014167BogPAVLKGEDSPHAKSLFAFARKVVTRVEEIKSTSSESVIQIQ*
Ga0181531_1066614923300014169BogENSPHAKSIYEFARKVVARVDEIKANAPASVIQIQ*
Ga0181531_1076044423300014169BogLRGEDSPHAKALFEFARRVVARVDEIKANATENVIQIQ*
Ga0182018_1010263843300014489PalsaSGDSGKPTVLEGENSSHAKSLFEFARNVIARVSEIKASAGDSVIQIQ*
Ga0182015_1004892413300014495PalsaVPAVLQGEDSPHAKSLFEFARNVVARVDEIKASSSESVIQIQ*
Ga0181525_1043349613300014654BogPVVLEGENSPHAKSIYDFARNVLARVTEIKANAPANVIQIQ*
Ga0137414_116701883300015051Vadose Zone SoilMVLAGEDFAAAKSLYAFARKVVTRVDEIKSTAGESVIQIQ*
Ga0132256_10194127813300015372Arabidopsis RhizosphereGEDAIHAKSLYEFARKVAARVDEIKLSAAESVIHIQ*
Ga0187818_1050747023300017823Freshwater SedimentLEGDSSPRSKSLYDFARKVIARVEEIKAAAPEGVIQIQ
Ga0187818_1054134813300017823Freshwater SedimentGENSPHAKSIYAFAQNVVTRAAEIKANAPASVIQIQ
Ga0187824_1039136513300017927Freshwater SedimentPVVLEGENSPLAKSLFDFARRVMGRVDEIRASAPSGVIQIQ
Ga0187825_1024971223300017930Freshwater SedimentRRGGDEGKPAILEGENSPHAKSLFEFARKVADRVQQIRASAGEGVIQIQ
Ga0187825_1040953713300017930Freshwater SedimentQPAVLAGENSPHAKSLYEFAHKVVGRIGEIKSKAPENVIQIQ
Ga0187803_1003471233300017934Freshwater SedimentSFLGNIALDPEVRKSGDGGKPVVLEGENSPHARSIYEFARNVVARVAEIKASAPASVIQI
Ga0187821_1043240413300017936Freshwater SedimentQLDPGIRQAGDAGQPAVLAGENSPQAKSLYEFARNVKARVEEIKASAPESVIQIQ
Ga0187809_1013356713300017937Freshwater SedimentLEGENSPHAKSIYEFAKNVAARTAEIKAAAPASVIQIQ
Ga0187819_1006614013300017943Freshwater SedimentVLEGPNSPHAKSLFEFARKVVARVDEIKASAPEGVIQIQ
Ga0187819_1033109823300017943Freshwater SedimentTVLEGENSPHAKSLYEFAHKVVARVDEIKSSASEGVIQIQ
Ga0187879_1004112943300017946PeatlandLQGENSAHAKSLFAFARNVVARVDEIKASSSQSVIQIQ
Ga0187779_1060317713300017959Tropical PeatlandAVLQGEDSPHAKSLFEFARKVVARVEEIKASSPEGVIQIQ
Ga0187781_1083549013300017972Tropical PeatlandLHGEESAHAKSLFQFARTVAARVEEIKSSSSEGVIQIQ
Ga0187781_1094332613300017972Tropical PeatlandPVVLEGENSPHAKSIYEFAHRVVDRVAEIKASAPAGVIQIQ
Ga0187777_1037381523300017974Tropical PeatlandALDPEVRKAGDGGKPVVLEGENSPHARSMYEFARKVVDRVAEIRANAPAGVIQIQ
Ga0187782_1035307323300017975Tropical PeatlandAGDGGKPVVREGESSLHAKSIYDFARKVVERVGEIKASAPTSVIQIQ
Ga0187816_1021843623300017995Freshwater SedimentVLEGENSPHAKSIYAFAQNVVTRAAEIKANAPASVIQIQ
Ga0187816_1021858823300017995Freshwater SedimentEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ
Ga0187876_119652923300018003PeatlandEGENSPHAKSIFEFARRVVARVGEIKAGEGASVIQIQ
Ga0187876_130950913300018003PeatlandSGDPAVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ
Ga0187810_1033266223300018012Freshwater SedimentVVLEGENSPHAKAIYDFARKVVERVGEIKANAPGNVIQIQ
Ga0187874_1008952333300018019PeatlandDGGSPSVLQGEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ
Ga0187857_1035806523300018026PeatlandKGEDSSHAKSLFAFARNVVARVEEIKAGSSESVIQIQ
Ga0187787_1045421123300018029Tropical PeatlandENSPHAKSLYEFTRRVVERVREIKAASPNSVIQIQ
Ga0187863_1029279923300018034PeatlandDGGVPAVLQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ
Ga0187871_1023171213300018042PeatlandGDGGSPAVLKGEDSPHAKSLFAFARNVVSRVEELKATSSESVIQIQ
Ga0187871_1088075123300018042PeatlandRKSGDGGTPAVLQGENSPHAKSLFTFARNVVARVEEIKASSSESVIQIQ
Ga0187859_1007076513300018047PeatlandVVLEGENSPHAKSIYEFAHRVAARVAEIKAGEGAGVISIQ
Ga0187859_1034227013300018047PeatlandKSGDGGVPAVLQGEDSPHAKSLFAFARNVVARVEEIKAGSSESVIQIQ
Ga0187858_1088027423300018057PeatlandAVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ
Ga0187772_1002133953300018085Tropical PeatlandGGKPVVLEGENSPHAKSMYEFARKVVERVGEIKASMPTGVIQIQ
Ga0187772_1100570623300018085Tropical PeatlandEDSAHAKSLFEFARKVVARVEEIKASSSEGVIQIQ
Ga0187772_1126481323300018085Tropical PeatlandAAGDSGTPAVLKGEDSPHAKSLFEFARKVVARVEEIKSSSSEGVIQIQ
Ga0187769_1082739013300018086Tropical PeatlandEGENSPHAKSLFAFAKKVMARVEEIKSSSSEGVIQIQ
Ga0187769_1141179423300018086Tropical PeatlandPEVRKAGDGGKPVVLEGENSPHAKSMFEFARKVVDRVAEIKASAPAPVIQIQ
Ga0187771_1003174213300018088Tropical PeatlandPAVLAGESSPHAKSLFEFAKRVVARVEEIKSSSSEGVIQIQ
Ga0187770_1096604913300018090Tropical PeatlandIRRAGDGGKPTVLEGENSPHAKSLFDFARKVIARVDQIKASSPESVIQIQ
Ga0066655_1120763923300018431Grasslands SoilEDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ
Ga0181514_161819313300019268PeatlandENSPHAKSIYEFARKVVARVDEIKANAPASVIQIQ
Ga0193735_109113123300020006SoilAGDGGQPMVLAGEDFAPAKSLYEFARNVVTRVDEIKSTAGESVIQIQ
Ga0193726_100680463300020021SoilGEDAPHAKSLYEFARKVVERIAEIKATADPSVIQIQ
Ga0193733_1000460123300020022SoilMVLAGEDFAPAKSLYEFARNVVTRVDEIKSSTGESVIQIQ
Ga0193733_102431923300020022SoilMVLAGEDFAPAKSLYEFARNVVTRVDEIKSTAGESVIQIQ
Ga0206352_1108612623300020078Corn, Switchgrass And Miscanthus RhizosphereENSAQAKPLFDFARKVVERVGQIRSSAGEGVIQIQ
Ga0179594_1022037623300020170Vadose Zone SoilIRKASDSGRPTVLAGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ
Ga0210407_1041746723300020579SoilKSGDGGKPVVLEGENSAHAKALFAFARKVEARVAEIRATSSEGVIQIH
Ga0210403_10001160223300020580SoilIVLEGENSPHAKSIYEFARKVVERVGEIKANAPGDVIQIQ
Ga0210403_1129440513300020580SoilGDSGKPTVLEGEGSAHAKSLFEFARKVIARVDEIKATAGESVIQIQ
Ga0210399_10001237163300020581SoilGAIQLDPELRRAGDSGKPVVLEGENTPHTKALYDFARKVVARVDEIRSHAPEGVIQIQ
Ga0210399_1104072723300020581SoilGAIQLDPELRRAGDSGKPVVLEGENTPHTKALYDFARKVVARVEEIRSHAPEGVIQIQ
Ga0210395_1128439523300020582SoilLDPEVRKSGDGGKPVVLEGENSPHAKSMYEFARRVVTRVDEIKASAPAGVIQIQ
Ga0210406_1014911513300021168SoilENSPHAKSLYDFTRKVIARVDEIRANATEGVIQIQ
Ga0210406_1139394023300021168SoilMVLAGEGSMPAKSLYDFARKVETRVDEIKSTAGESVIQIQ
Ga0210405_1099955123300021171SoilVVLEGENSAHAKPLFAFARKVEARVAEIRATAPESVIQIQ
Ga0210408_1014269213300021178SoilGENSPHAKSLYDFARKVITRVDEIKSSAGESVIQIQ
Ga0210385_1155673613300021402SoilPEIGRGGDSGSPAVLKGESSSHAKSLFEFARKVVVRVEEIKATASENVIQIQ
Ga0210397_1074698223300021403SoilVVLEGENSPHAKSIYEFARNVLARVTEIKANAPANVIQIQ
Ga0210389_1014259223300021404SoilEGENSPHAKSIYEFARNVVKRSDEIRASAAPSVIQIQ
Ga0210389_1080171913300021404SoilLQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ
Ga0210387_1132352313300021405SoilEESSHAKPLYEFARKVVARVEQIRATAPEGVISIQ
Ga0210383_1155579313300021407SoilGENSPHAKSIYAFARRVLDRVAEIKLNAPGNVIQIQ
Ga0210394_1107056613300021420SoilGQPVVLEGENSPHAKSLFEFARKVMARVDEIKSAAPASVIQIQ
Ga0210384_1079901013300021432SoilRKSGDGGKPVVLEGENSAHAKALFAFARKVEARVAEIRATAPESVIQIQ
Ga0210384_1185440313300021432SoilVLKDVNSPSVKSLYDFARKVVARVTEVKSNAPESVIQIQ
Ga0210402_1185973413300021478SoilGDSGSPAVLKGEGSSHAKSLFEFARKVVARVEEIKATASENVIQIQ
Ga0247794_1032162913300024055SoilLAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ
Ga0207416_113376723300025134Iron-Sulfur Acid SpringLEGENSSHAKSLFEFARNVIARVSEIKASAGESVIQIQ
Ga0208691_103621823300025612PeatlandVRKSGDSGKPVVLEGENSAHAKSILEFARRVRARVAEIKASEGASVIQIQ
Ga0207710_1015085523300025900Switchgrass RhizosphereIRKASDSGQPTVLAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ
Ga0207685_1038879013300025905Corn, Switchgrass And Miscanthus RhizospherePDIRKASDSGRPTVLAGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ
Ga0207699_1007437033300025906Corn, Switchgrass And Miscanthus RhizospherePVVLAGEGSAPAKSLYDFARKVVTRVDEIKSAAGESVIQIQ
Ga0207705_1125267513300025909Corn RhizosphereLEGETSEHAKSIFAFAHNVKARVEELTATGGGSVISID
Ga0207684_1163951923300025910Corn, Switchgrass And Miscanthus RhizosphereLDGESSPHAKALFEFARRVAERVEQIKSSAPESVIQIQ
Ga0207695_1148741013300025913Corn RhizosphereVLDGEGSPHAKSLFDFARKVETRVKEINAAAPESVIQIQ
Ga0207671_1092127713300025914Corn RhizosphereDEGKPAVLEGENSPHAKPLFDFARKVAERVGQIRSSAGEGVIQIQ
Ga0207693_1118534523300025915Corn, Switchgrass And Miscanthus RhizospherePEIRKAGDEGRPAVLEGETSVHAKPLFDFARQVAQRVEEIKSSAPESVIQIQ
Ga0207649_1001978953300025920Corn RhizosphereGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ
Ga0207646_1032137923300025922Corn, Switchgrass And Miscanthus RhizosphereVLQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ
Ga0207694_1071600023300025924Corn RhizosphereDPEIRRAGDEGKPAVLEGENSPHAKPLFDFARKVAERVGQIRSSAGEGVIQIQ
Ga0207700_1183777423300025928Corn, Switchgrass And Miscanthus RhizosphereLREAGDSGKPAALAGQDSPVSKSLYDFARKVVARVEEINANASEGVIHVQ
Ga0207664_1078719023300025929Agricultural SoilKPVVLEGENTPHTKALYDFARKVVARVDEIRSHAPEGVIQIQ
Ga0207664_1144581423300025929Agricultural SoilVLEGENSLHAKPLFDFARRVAERVDQIRASAPESVIQIQ
Ga0207664_1157466523300025929Agricultural SoilRKSGDEGKPAVLEGENSPHAKALFDFAHRVVERVEQIKSAAPESVIQIQ
Ga0207686_1150233223300025934Miscanthus RhizosphereLEGTESAHAKSLYDFTRKVVSRVDEIEAAAPQGVIQIQ
Ga0207691_1088763423300025940Miscanthus RhizosphereASDSGRPTVLEGTESAHAKSLYDFTRRVVSRVDEIEAAAPQGVIQIQ
Ga0207667_1069534413300025949Corn RhizosphereVLEGENSPHAKSIYEFARKVIDRVGEIKANAPAGVIQIQ
Ga0207703_1217513913300026035Switchgrass RhizosphereASDSGTPTVLEGENSAHAKSLYDFANKVVTRVDEIEANAPRGVIQIQ
Ga0207678_1036200713300026067Corn RhizospherePIVIEGEDSAHAKSIYEFARRVVNRVDEIKAAAPQDVIQIQ
Ga0209350_108738113300026277Grasslands SoilKAGDGGKPLVLEGENSPSAQSLYEFARKVIARVTEIKAGESEGVIHVQ
Ga0209471_119592713300026318SoilEGEDSPHAKSLFEFARRVISRVADIKANAPEGVIQIQ
Ga0209804_121660123300026335SoilGQPAVLAGEDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ
Ga0257180_103502923300026354SoilVLKGEDSPHAKSLFAFARKVVERVDEIKASSSASVVQIQ
Ga0257160_104938113300026489SoilVLKGEDSPHAKSLFAVARKVAARVDEIKAGSSESVIQIQ
Ga0209806_118506723300026529SoilLVLAGENAPNAKSLYEFARKVVTRVEEIKAAAGEGVIQIQ
Ga0209577_1025076323300026552SoilGENSPHAKPLFEFARRVVERVEQIKSAAPESVIQIQ
Ga0209421_111235523300027432Forest SoilAGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ
Ga0208199_106013023300027497Peatlands SoilGGSPSVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ
Ga0209523_111110823300027548Forest SoilGETSPLAKSLYDFTRKVISRVDEIRNSAPEGVIQIQ
Ga0209733_103223213300027591Forest SoilGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ
Ga0209528_106395923300027610Forest SoilSGDGGKPVVLEGENSAHAKPLFAFARRVEARVAEIRATAPESVIQIQ
Ga0209007_100954913300027652Forest SoilEGENSPHAKSIYEFARNVVTRTTEIRVNAPGSVIQIQ
Ga0209736_107381813300027660Forest SoilVELQGRLPEIRKAGDNGKPTVLNGEDYAHAKSLFEFARKVVDRVREITADASESVIQIQ
Ga0209736_119769113300027660Forest SoilVLEGESSPHAKSLFDFARNVITRVGEIKSSAGESVIQIQ
Ga0209328_1023888513300027727Forest SoilVLAGENSASGKSLYDFARKVITRVDQIKSTAGESVIQ
Ga0209908_1001903913300027745Thawing PermafrostVLEGENSPHAKSMFGFARRVVARVGEIKAGETASVIQIQ
Ga0209073_1044989913300027765Agricultural SoilGENSPHAKSLFEFARKVADRVQQIRASSGEGVIQIQ
Ga0209810_115330823300027773Surface SoilRPAVLEGESSPHAKPLFDFARRVAERVQQIKSAAPEGVVQIQ
Ga0209656_1004779543300027812Bog Forest SoilGESSAHAKSLFEFARKVVARVGEIKSNQSDSVIQIQ
Ga0209039_1001259263300027825Bog Forest SoilSVELDAEIRKSGDSGTPSVLQGEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ
Ga0209274_1007047613300027853SoilRQRQAAVLEGENSSHAKSLYEFARKVIARVEEIKSSAGESVIQIQ
Ga0209274_1059897523300027853SoilENSPHAKSLYDFARRVVARVDEIKSNAGESVIQIQ
Ga0209517_1004639353300027854Peatlands SoilEDSSHAKSLFAFARNVAARVEEIKASSSESVIQIQ
Ga0209517_1010095743300027854Peatlands SoilEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ
Ga0209701_1006608743300027862Vadose Zone SoilPEIRKSGDSGAPSVLQGEDSPHAKSLFAFARNVAARVEEIKASSPASVIQIQ
Ga0209167_1002504543300027867Surface SoilTVLEGEDSPHAKGLFDFARRVVQRTDEIKSQASEGVIQIQ
Ga0209579_1017784813300027869Surface SoilVLEGENSPHAKSIYQFAQRVVARVGEIKASEPASVIQIQ
Ga0209579_1065780613300027869Surface SoilGDGGQPMVLAGEGSAPANSLFDFARKVVTRVDEIKSAAGESVIQIQ
Ga0209283_1074713223300027875Vadose Zone SoilLEGENSPHAKSMYEFARNVIARVGEIKAGEGASVIQIQ
Ga0209590_1000287013300027882Vadose Zone SoilGDGGQPLVLAGEDFAPAKSLYEFARKVVTRVDEIKSTAGESVIQIQ
Ga0209275_1011008723300027884SoilTVLEGENSPHAKSLYDFARKVITRVDEIKSSAGESVIQIQ
Ga0209275_1023421213300027884SoilPVVLEGENSPHAKSIYEFAKNVVTRTAEIRANAPAGVIQIQ
Ga0209068_1051331713300027894WatershedsGEDSPHAKSLYEFARKVVARVEEIQSSSSEGVIQIQ
Ga0209488_1047310123300027903Vadose Zone SoilVRKSGDGGKPVVLEGENSPHAKSLFAFARKVIARVDEVKASAPASVIQIQ
Ga0209698_1006804313300027911WatershedsEGEDSPHAKSLFAFARNVVTRVEEIKAGSSESVIQIQ
Ga0265357_103039223300028023RhizosphereELDPEVRKAGDGGTPIVMQGENSPHAKSMYAFARNVVTRVDEIKASAPAGVISIQ
Ga0268265_1045068823300028380Switchgrass RhizosphereGEGSSSGKSLYDFARKVVTRVDEIKASAGESVIQIQ
Ga0302206_114360323300028734FenGEDAPHAKSLFEFARKVVARVDEIKASSSENVIQIQ
Ga0302267_1038915023300028745BogGGTPAVLQGEDSPHAKSLFAFARKVVARVEEIKAGSSESVIQIQ
Ga0302222_1000179213300028798PalsaENSPHAKSIFEFARRVAARVGEIKAGESASVISIQ
Ga0302163_1024801313300028868FenAVLAGEDSPHAKSLYEFARKVVTRVDEIKASAGEGVIQIQ
Ga0308309_1178807823300028906SoilVLEGEDSPHAKSIYEFARRVVERVGEIKANAPGNVIQIQ
Ga0222749_1005946033300029636SoilEGTASGKSLFDFARKVVTRVDEIKANAGESVIQIQ
Ga0311341_1003229613300029908BogEDSPHAKSLFAFARKVVARVEEIKAGSSESVIQIQ
Ga0311371_1110220213300029951PalsaPTVLQGENSSHAKSLFAFAHNVVSRVDEIKAGSSESVIQIQ
Ga0302150_1035065823300029956BogENSPHAKSIFAFARKVVARVGEIKAGETASVISIQ
Ga0311338_1115441523300030007PalsaPIVMQGESSPHAKSMYAFARNVVTRVDEIKASAPAGVISIQ
Ga0302300_122738213300030042PalsaVLEGENSPHAKSIFEFARRVAARVGEIKAGESASVISIQ
Ga0302195_1009070313300030051BogGTPAVLQGEDSPHAKSLFAFARKVVARVEEIKAGSSESVIQIQ
Ga0316363_1039451613300030659Peatlands SoilRQAGDTGKAVVLDGENSPAAKSLYEFARKVVARVDEIKAGASENVIQIQ
Ga0310039_1004118313300030706Peatlands SoilKAGDGGKPVVLEGETSPHAKSMYAFARKVVERVAEIKSSAPANVIQIQ
Ga0307482_103042813300030730Hardwood Forest SoilAVLEGESSPHAKALFEFANRVVDRVEQIKSTAPEGVIQIQ
Ga0265746_100427013300030815SoilPEVRKSGDGGKPVVLEGENSPHAKSMYAFARKVLGRVEEIKANAPASVIQIQ
Ga0170834_10268153423300031057Forest SoilEVRKSGDGGKPVVLEGENSPHAKSMYAFARKVLARVEEIKANALASVIQIQ
Ga0170834_10526920313300031057Forest SoilPEIRKSGDSGSPSVLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ
Ga0170824_10591595623300031231Forest SoilTVLDGEDSPHAKSLYEFAHKVVTRIAEIKATAGESVIQIQ
Ga0170824_10875940933300031231Forest SoilVLQGEDSPHAKSLFAFARNVVARVDEVKASSSESVIQIK
Ga0302307_1010790213300031233PalsaGSPTVLQGENSSHAKSLFAFAHNVVSRVDEIKAGSSESVIQIQ
Ga0265325_1013059013300031241RhizosphereEGEDSAHAKSLFAFARNVVARVEQIKSSSPEGVIQIQ
Ga0265316_1009045013300031344RhizosphereLEGENSPHAKSIYDFAKRVIERVGEIKAAAPGNVIQIQ
Ga0170820_1012093923300031446Forest SoilEGKPAVLEGENSPHAKALFDFARRVVERVEQIKSAAPESVIQIQ
Ga0302320_1093309513300031524BogGEDSPHAKSLFAFARKVVARVEEIKAGSSESVIQIQ
Ga0302326_1205711513300031525PalsaEIRKAGDGGVPAVLQGEDSPHAKSLFEFARNVVARVDEIKASSSESVIQIQ
Ga0318528_1065548813300031561SoilLEGENSPHAKSIYDFARRVIDRVGEIKANAPGNVIQIQ
Ga0310686_10435147143300031708SoilVLEGENSSHAKALYEFARKVIARVDEIKSSAGESVIQIQ
Ga0310686_10937751113300031708SoilGDGGKPVVLEGETSLHAKSIYAFARKVLARVEEIKANAPASVIQIQ
Ga0307469_1106792013300031720Hardwood Forest SoilALREAGDSGKPVVLEGENSPSAQSLYEFARKVVARVAEIKAAESESVIHVQ
Ga0307469_1115920123300031720Hardwood Forest SoilEGENSPHAKSIYEFARKVIERVGEIKANAPGNVIQIQ
Ga0318501_1057902213300031736SoilVLEGENSPHAKSLFDFARRVAARVDEIRASAPTGVIQIQ
Ga0307468_10016359113300031740Hardwood Forest SoilPAVLEGEDSPHAKSLFEFARRVVGRVDEIRSHSVDNVIQIQ
Ga0307475_1099878923300031754Hardwood Forest SoilEDSAHAKSLYEFARKVADRVREITADTPESVIQIQ
Ga0318536_1057013323300031893SoilPTVLEGENSPHAKSLFDFARRVAARVDEIRASAPTGVIQIQ
Ga0318551_1079946213300031896SoilVRKSGDGGKPVVLEGENSPHAKSMYEFARKVVDRVGEIKANSPGNVIQIQ
Ga0306923_1018751733300031910SoilLEGENSPHAKSIYDFARKVVERVSEIKAASPGNVIQIQ
Ga0306921_1030884233300031912SoilPEVRKSGDGGKPVVLEGENSPHAKSMYEFARKVVDRVGEIKANSPGNVIQIQ
Ga0306926_1121534523300031954SoilDENSPSVKSLYDFARKVIARVTEIKSTAPESVIQIQ
Ga0307479_1048829123300031962Hardwood Forest SoilGESSAHAKSLYAFARNVEARVAEIRANAPEGVIQIQ
Ga0307479_1080963123300031962Hardwood Forest SoilESSSHAKALFDFAHRVVERVEQIKSAAPEGVIQIQ
Ga0307479_1100632513300031962Hardwood Forest SoilIRKSGDSGSPSVLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ
Ga0318514_1072284623300032066SoilGGDTGKPTVLEGENSPHAKSLFDFARRVAARVDEIRASAPTGVIQIQ
Ga0307471_10295423113300032180Hardwood Forest SoilDSGSPAVLKGEDSPHAKSLFEFARKVVARVEEIKASSSASVVQIH
Ga0307472_10112281613300032205Hardwood Forest SoilTVLEGEASPHAKSLYDFARNVIARVDEIKSSAGESVIQIQ
Ga0307472_10226563513300032205Hardwood Forest SoilALAGEDLAAAKSLYEFARKVVTRVDEIKSTAGESVIQIQ
Ga0348332_1438058133300032515Plant LitterENSPHAKSIFAFARRVAARVVEIKAGESASVIQIQ
Ga0335082_1107162413300032782SoilRSGDSGQPAVLKGEADKHAKSLFDFARKVAIRVEEIKSSSPENVIQIQ
Ga0335079_1138979613300032783SoilVLAGENSPHAKSLYDFTRKVISRVDEIKASAPEGVIQIQ
Ga0335079_1211086823300032783SoilAVLEGEESQPAKSLYEFARKVVTRVDEIKASAPEGVIQIQ
Ga0335078_1240726913300032805SoilENSPHAKSIYDFARKVVERVGEIKASAPGSVIQIQ
Ga0335080_1172860723300032828SoilDPQLREAGDSGKPVALAGQDSPLAKSLYDFARKVVARVDEINANASTGVIHIQ
Ga0335070_1051076423300032829SoilEDSPHAKSLFEFARKVAARVDEIKSSSSEGVIQIQ
Ga0335081_1006647913300032892SoilGKPAVLEGENSPHAKSLFDFARRVAERVEQIKSAAPEGVIQIQ
Ga0335081_1029075013300032892SoilVLAGEDSRQAKSLYDFTRKVAARVEEIKANAPESVIQIQ
Ga0335076_1126839613300032955SoilDGGSPTVLQGEESSHAKSLFAFARNVVARVEEIKASSSESVIQIQ
Ga0335084_1067631123300033004SoilENSPHAKSIYDFAKRVVERVGEIKAASPGNVIQIQ
Ga0335077_1144360213300033158SoilGPDSPHAKSLFEFARKVVARVDEIKASAPEGVIQIQ
Ga0326726_1033333123300033433Peat SoilEDSPHAKSLFAFARKVIARVEEIKASSSEGVIQIQ
Ga0326726_1175921413300033433Peat SoilSPAVLEGEDSPHAKSLYEFAHRVVARVEEIKSSSSESVIQIQ
Ga0314867_119091_465_5843300033808PeatlandVLEGPDSPHAKSLFEFARKVVARVEEIKASASEGVIQIQ
Ga0370492_0037815_3_1103300034282Untreated Peat SoilENSPHAKSIFAFARRVAARVGEIKAGESASVISIQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.