Basic Information | |
---|---|
Family ID | F005867 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 388 |
Average Sequence Length | 40 residues |
Representative Sequence | LPDAMKPGFHCVRTHWIRGFMAFQLARRTRTVMLMVPE |
Number of Associated Samples | 222 |
Number of Associated Scaffolds | 388 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 23.62 % |
% of genes near scaffold ends (potentially truncated) | 57.22 % |
% of genes from short scaffolds (< 2000 bps) | 86.86 % |
Associated GOLD sequencing projects | 189 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.825 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.340 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.515 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.082 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.94% β-sheet: 0.00% Coil/Unstructured: 56.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 388 Family Scaffolds |
---|---|---|
PF08044 | DUF1707 | 3.61 |
PF07729 | FCD | 2.32 |
PF00589 | Phage_integrase | 2.32 |
PF00254 | FKBP_C | 1.80 |
PF05506 | PLipase_C_C | 1.55 |
PF14226 | DIOX_N | 1.55 |
PF07690 | MFS_1 | 1.55 |
PF01028 | Topoisom_I | 1.29 |
PF01047 | MarR | 1.29 |
PF01063 | Aminotran_4 | 1.03 |
PF00196 | GerE | 1.03 |
PF13561 | adh_short_C2 | 1.03 |
PF00271 | Helicase_C | 1.03 |
PF05977 | MFS_3 | 1.03 |
PF06628 | Catalase-rel | 1.03 |
PF04978 | DUF664 | 1.03 |
PF00561 | Abhydrolase_1 | 0.77 |
PF01557 | FAA_hydrolase | 0.77 |
PF12697 | Abhydrolase_6 | 0.77 |
PF02899 | Phage_int_SAM_1 | 0.77 |
PF13242 | Hydrolase_like | 0.77 |
PF11236 | DUF3037 | 0.77 |
PF12802 | MarR_2 | 0.77 |
PF04261 | Dyp_perox | 0.77 |
PF13419 | HAD_2 | 0.77 |
PF03551 | PadR | 0.52 |
PF13828 | DUF4190 | 0.52 |
PF01636 | APH | 0.52 |
PF00005 | ABC_tran | 0.52 |
PF13005 | zf-IS66 | 0.52 |
PF04266 | ASCH | 0.52 |
PF04909 | Amidohydro_2 | 0.52 |
PF01872 | RibD_C | 0.52 |
PF08241 | Methyltransf_11 | 0.52 |
PF08843 | AbiEii | 0.52 |
PF04542 | Sigma70_r2 | 0.52 |
PF03050 | DDE_Tnp_IS66 | 0.52 |
PF02463 | SMC_N | 0.52 |
PF01479 | S4 | 0.52 |
PF14833 | NAD_binding_11 | 0.52 |
PF01546 | Peptidase_M20 | 0.52 |
PF14333 | DUF4389 | 0.52 |
PF13649 | Methyltransf_25 | 0.52 |
PF00953 | Glycos_transf_4 | 0.52 |
PF04493 | Endonuclease_5 | 0.52 |
PF00403 | HMA | 0.52 |
PF07884 | VKOR | 0.52 |
PF03352 | Adenine_glyco | 0.52 |
PF12847 | Methyltransf_18 | 0.26 |
PF13672 | PP2C_2 | 0.26 |
PF09678 | Caa3_CtaG | 0.26 |
PF05995 | CDO_I | 0.26 |
PF01979 | Amidohydro_1 | 0.26 |
PF12680 | SnoaL_2 | 0.26 |
PF02775 | TPP_enzyme_C | 0.26 |
PF13602 | ADH_zinc_N_2 | 0.26 |
PF02077 | SURF4 | 0.26 |
PF03640 | Lipoprotein_15 | 0.26 |
PF00580 | UvrD-helicase | 0.26 |
PF13520 | AA_permease_2 | 0.26 |
PF13147 | Obsolete Pfam Family | 0.26 |
PF12072 | RNase_Y_N | 0.26 |
PF09339 | HTH_IclR | 0.26 |
PF03193 | RsgA_GTPase | 0.26 |
PF00291 | PALP | 0.26 |
PF00441 | Acyl-CoA_dh_1 | 0.26 |
PF01544 | CorA | 0.26 |
PF13193 | AMP-binding_C | 0.26 |
PF02245 | Pur_DNA_glyco | 0.26 |
PF04149 | DUF397 | 0.26 |
PF00929 | RNase_T | 0.26 |
PF13662 | Toprim_4 | 0.26 |
PF00188 | CAP | 0.26 |
PF01037 | AsnC_trans_reg | 0.26 |
PF06245 | DUF1015 | 0.26 |
PF14016 | DUF4232 | 0.26 |
PF13474 | SnoaL_3 | 0.26 |
PF08281 | Sigma70_r4_2 | 0.26 |
PF13302 | Acetyltransf_3 | 0.26 |
PF08669 | GCV_T_C | 0.26 |
PF00378 | ECH_1 | 0.26 |
PF00890 | FAD_binding_2 | 0.26 |
PF02806 | Alpha-amylase_C | 0.26 |
PF07592 | DDE_Tnp_ISAZ013 | 0.26 |
PF12840 | HTH_20 | 0.26 |
PF02810 | SEC-C | 0.26 |
PF07311 | Dodecin | 0.26 |
PF12867 | DinB_2 | 0.26 |
PF10417 | 1-cysPrx_C | 0.26 |
PF00924 | MS_channel | 0.26 |
PF00300 | His_Phos_1 | 0.26 |
PF00584 | SecE | 0.26 |
PF13191 | AAA_16 | 0.26 |
PF01168 | Ala_racemase_N | 0.26 |
PF00583 | Acetyltransf_1 | 0.26 |
PF13350 | Y_phosphatase3 | 0.26 |
PF00275 | EPSP_synthase | 0.26 |
PF00440 | TetR_N | 0.26 |
PF01193 | RNA_pol_L | 0.26 |
PF13280 | WYL | 0.26 |
PF00318 | Ribosomal_S2 | 0.26 |
PF13401 | AAA_22 | 0.26 |
PF13344 | Hydrolase_6 | 0.26 |
PF00498 | FHA | 0.26 |
PF04672 | Methyltransf_19 | 0.26 |
PF01022 | HTH_5 | 0.26 |
PF00753 | Lactamase_B | 0.26 |
PF08240 | ADH_N | 0.26 |
PF02148 | zf-UBP | 0.26 |
PF04185 | Phosphoesterase | 0.26 |
PF01263 | Aldose_epim | 0.26 |
PF14014 | DUF4230 | 0.26 |
PF00795 | CN_hydrolase | 0.26 |
PF13359 | DDE_Tnp_4 | 0.26 |
PF04338 | DUF481 | 0.26 |
PF00534 | Glycos_transf_1 | 0.26 |
PF00892 | EamA | 0.26 |
PF01243 | Putative_PNPOx | 0.26 |
PF14079 | DUF4260 | 0.26 |
PF00135 | COesterase | 0.26 |
PF00652 | Ricin_B_lectin | 0.26 |
PF00877 | NLPC_P60 | 0.26 |
PF00248 | Aldo_ket_red | 0.26 |
PF01613 | Flavin_Reduct | 0.26 |
PF09206 | ArabFuran-catal | 0.26 |
PF00376 | MerR | 0.26 |
PF04545 | Sigma70_r4 | 0.26 |
COG ID | Name | Functional Category | % Frequency in 388 Family Scaffolds |
---|---|---|---|
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 2.32 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 2.32 |
COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 2.06 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 1.29 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.03 |
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 1.03 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.77 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.77 |
COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.77 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.52 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.52 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.52 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.52 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.52 |
COG3097 | Uncharacterized conserved protein YqfB, UPF0267 family | Function unknown [S] | 0.52 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.52 |
COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.52 |
COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.52 |
COG2411 | Predicted RNA-binding protein, contains PUA-like ASCH domain | General function prediction only [R] | 0.52 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.52 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.52 |
COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.52 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.52 |
COG4405 | Predicted RNA-binding protein YhfF, contains PUA-like ASCH domain | General function prediction only [R] | 0.52 |
COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.52 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.52 |
COG1515 | Deoxyinosine 3'-endonuclease (endonuclease V) | Replication, recombination and repair [L] | 0.52 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.52 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.26 |
COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 0.26 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.26 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.26 |
COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.26 |
COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.26 |
COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.26 |
COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.26 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.26 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.26 |
COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.26 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.26 |
COG0690 | Preprotein translocase subunit SecE | Intracellular trafficking, secretion, and vesicular transport [U] | 0.26 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.26 |
COG2443 | Preprotein translocase subunit Sss1 | Intracellular trafficking, secretion, and vesicular transport [U] | 0.26 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.26 |
COG1761 | DNA-directed RNA polymerase, subunit L/RPAC2 | Transcription [K] | 0.26 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.26 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.26 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.26 |
COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 0.26 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.26 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.26 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.82 % |
Unclassified | root | N/A | 39.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig06230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
2124908016|OU_2_1_1_newblercontig117652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 553 | Open in IMG/M |
2170459013|GO6OHWN01AD627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 527 | Open in IMG/M |
2170459019|G14TP7Y01CYB3V | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
2170459024|GZTSFBX01D18PI | Not Available | 527 | Open in IMG/M |
3300000956|JGI10216J12902_102540973 | Not Available | 535 | Open in IMG/M |
3300000956|JGI10216J12902_118667390 | Not Available | 553 | Open in IMG/M |
3300001867|JGI12627J18819_10409540 | Not Available | 552 | Open in IMG/M |
3300004479|Ga0062595_101545732 | Not Available | 615 | Open in IMG/M |
3300005329|Ga0070683_100057551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3611 | Open in IMG/M |
3300005329|Ga0070683_100342982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1422 | Open in IMG/M |
3300005329|Ga0070683_101348627 | Not Available | 685 | Open in IMG/M |
3300005330|Ga0070690_100853122 | Not Available | 710 | Open in IMG/M |
3300005331|Ga0070670_100729913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 892 | Open in IMG/M |
3300005332|Ga0066388_100404923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 2009 | Open in IMG/M |
3300005334|Ga0068869_100153896 | Not Available | 1785 | Open in IMG/M |
3300005335|Ga0070666_10441725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 939 | Open in IMG/M |
3300005337|Ga0070682_100635869 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300005337|Ga0070682_100688036 | Not Available | 818 | Open in IMG/M |
3300005338|Ga0068868_100277919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1416 | Open in IMG/M |
3300005338|Ga0068868_100283295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1403 | Open in IMG/M |
3300005344|Ga0070661_100639734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 863 | Open in IMG/M |
3300005355|Ga0070671_101556478 | Not Available | 585 | Open in IMG/M |
3300005356|Ga0070674_100550700 | Not Available | 968 | Open in IMG/M |
3300005364|Ga0070673_100340644 | Not Available | 1329 | Open in IMG/M |
3300005364|Ga0070673_101021046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 771 | Open in IMG/M |
3300005366|Ga0070659_100132822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2022 | Open in IMG/M |
3300005366|Ga0070659_101414199 | Not Available | 618 | Open in IMG/M |
3300005367|Ga0070667_100426400 | Not Available | 1210 | Open in IMG/M |
3300005434|Ga0070709_11357524 | Not Available | 574 | Open in IMG/M |
3300005434|Ga0070709_11481452 | Not Available | 551 | Open in IMG/M |
3300005435|Ga0070714_101039942 | Not Available | 797 | Open in IMG/M |
3300005435|Ga0070714_101195990 | Not Available | 741 | Open in IMG/M |
3300005435|Ga0070714_101619046 | Not Available | 632 | Open in IMG/M |
3300005436|Ga0070713_101737541 | Not Available | 606 | Open in IMG/M |
3300005437|Ga0070710_10109935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1654 | Open in IMG/M |
3300005458|Ga0070681_10179692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2037 | Open in IMG/M |
3300005458|Ga0070681_10190805 | Not Available | 1968 | Open in IMG/M |
3300005526|Ga0073909_10051196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha | 1500 | Open in IMG/M |
3300005530|Ga0070679_100389603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1340 | Open in IMG/M |
3300005535|Ga0070684_101772382 | Not Available | 583 | Open in IMG/M |
3300005539|Ga0068853_100030701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4540 | Open in IMG/M |
3300005543|Ga0070672_100242916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1515 | Open in IMG/M |
3300005543|Ga0070672_101297007 | Not Available | 650 | Open in IMG/M |
3300005545|Ga0070695_100310637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1168 | Open in IMG/M |
3300005545|Ga0070695_101690585 | Not Available | 530 | Open in IMG/M |
3300005548|Ga0070665_100347011 | Not Available | 1489 | Open in IMG/M |
3300005548|Ga0070665_100386258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1407 | Open in IMG/M |
3300005548|Ga0070665_101332541 | Not Available | 727 | Open in IMG/M |
3300005553|Ga0066695_10645424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
3300005563|Ga0068855_100281549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1846 | Open in IMG/M |
3300005563|Ga0068855_100731533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. C448 | 1056 | Open in IMG/M |
3300005563|Ga0068855_101378011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 727 | Open in IMG/M |
3300005563|Ga0068855_101612915 | Not Available | 664 | Open in IMG/M |
3300005563|Ga0068855_102121863 | Not Available | 565 | Open in IMG/M |
3300005564|Ga0070664_100059086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3262 | Open in IMG/M |
3300005564|Ga0070664_100109951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2404 | Open in IMG/M |
3300005564|Ga0070664_100149892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2058 | Open in IMG/M |
3300005566|Ga0066693_10084502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 1122 | Open in IMG/M |
3300005614|Ga0068856_101111829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 807 | Open in IMG/M |
3300005614|Ga0068856_101724674 | Not Available | 638 | Open in IMG/M |
3300005614|Ga0068856_102177722 | Not Available | 563 | Open in IMG/M |
3300005617|Ga0068859_100465861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1359 | Open in IMG/M |
3300005618|Ga0068864_102686903 | Not Available | 503 | Open in IMG/M |
3300005718|Ga0068866_10053739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2060 | Open in IMG/M |
3300005718|Ga0068866_10185235 | Not Available | 1233 | Open in IMG/M |
3300005719|Ga0068861_100230127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1571 | Open in IMG/M |
3300005834|Ga0068851_10061008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1932 | Open in IMG/M |
3300005840|Ga0068870_10378612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 916 | Open in IMG/M |
3300005841|Ga0068863_102676777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 507 | Open in IMG/M |
3300005842|Ga0068858_100389049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1339 | Open in IMG/M |
3300005842|Ga0068858_102236956 | Not Available | 540 | Open in IMG/M |
3300005842|Ga0068858_102361366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300006028|Ga0070717_11514681 | Not Available | 608 | Open in IMG/M |
3300006163|Ga0070715_10030947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 2168 | Open in IMG/M |
3300006173|Ga0070716_100134391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 1568 | Open in IMG/M |
3300006173|Ga0070716_101692567 | Not Available | 521 | Open in IMG/M |
3300006175|Ga0070712_101412293 | Not Available | 607 | Open in IMG/M |
3300006237|Ga0097621_100256648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1532 | Open in IMG/M |
3300006358|Ga0068871_102294697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 514 | Open in IMG/M |
3300006755|Ga0079222_10033589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2221 | Open in IMG/M |
3300006755|Ga0079222_10259125 | Not Available | 1101 | Open in IMG/M |
3300006755|Ga0079222_10701900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 801 | Open in IMG/M |
3300006804|Ga0079221_10095911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1446 | Open in IMG/M |
3300006804|Ga0079221_10478823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 800 | Open in IMG/M |
3300006804|Ga0079221_11375623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
3300006806|Ga0079220_10081342 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
3300006806|Ga0079220_10166158 | Not Available | 1236 | Open in IMG/M |
3300006806|Ga0079220_11046790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium aerolatum | 654 | Open in IMG/M |
3300006854|Ga0075425_100571628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1301 | Open in IMG/M |
3300006871|Ga0075434_100911832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 893 | Open in IMG/M |
3300006871|Ga0075434_101629632 | Not Available | 654 | Open in IMG/M |
3300006871|Ga0075434_102014600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces spectabilis | 582 | Open in IMG/M |
3300006881|Ga0068865_100185684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1604 | Open in IMG/M |
3300006881|Ga0068865_100451806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1062 | Open in IMG/M |
3300006881|Ga0068865_100465740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1048 | Open in IMG/M |
3300006881|Ga0068865_102133218 | Not Available | 510 | Open in IMG/M |
3300006903|Ga0075426_10410709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 999 | Open in IMG/M |
3300006904|Ga0075424_101662551 | Not Available | 676 | Open in IMG/M |
3300006914|Ga0075436_101366465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300006954|Ga0079219_11996541 | Not Available | 551 | Open in IMG/M |
3300006954|Ga0079219_12029785 | Not Available | 548 | Open in IMG/M |
3300009036|Ga0105244_10142366 | Not Available | 1152 | Open in IMG/M |
3300009092|Ga0105250_10141056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 999 | Open in IMG/M |
3300009093|Ga0105240_10459612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae | 1423 | Open in IMG/M |
3300009093|Ga0105240_11923699 | Not Available | 615 | Open in IMG/M |
3300009098|Ga0105245_10102668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2648 | Open in IMG/M |
3300009098|Ga0105245_10912393 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300009098|Ga0105245_11029294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 868 | Open in IMG/M |
3300009098|Ga0105245_11066669 | Not Available | 854 | Open in IMG/M |
3300009098|Ga0105245_11117344 | Not Available | 835 | Open in IMG/M |
3300009098|Ga0105245_11790406 | Not Available | 667 | Open in IMG/M |
3300009098|Ga0105245_12146491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
3300009101|Ga0105247_10045047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2707 | Open in IMG/M |
3300009101|Ga0105247_10380635 | Not Available | 1000 | Open in IMG/M |
3300009101|Ga0105247_10799530 | Not Available | 719 | Open in IMG/M |
3300009148|Ga0105243_10154045 | Not Available | 1974 | Open in IMG/M |
3300009148|Ga0105243_10182544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1826 | Open in IMG/M |
3300009148|Ga0105243_10202698 | Not Available | 1741 | Open in IMG/M |
3300009148|Ga0105243_10643598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1026 | Open in IMG/M |
3300009148|Ga0105243_12361361 | Not Available | 570 | Open in IMG/M |
3300009162|Ga0075423_10645825 | Not Available | 1116 | Open in IMG/M |
3300009162|Ga0075423_11274358 | Not Available | 785 | Open in IMG/M |
3300009174|Ga0105241_10806429 | Not Available | 865 | Open in IMG/M |
3300009176|Ga0105242_10034042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4083 | Open in IMG/M |
3300009177|Ga0105248_10376728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Krasilnikovia → Krasilnikovia cinnamomea | 1598 | Open in IMG/M |
3300009177|Ga0105248_12666958 | Not Available | 570 | Open in IMG/M |
3300009545|Ga0105237_10494102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1230 | Open in IMG/M |
3300009545|Ga0105237_10684744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1032 | Open in IMG/M |
3300009545|Ga0105237_11198277 | Not Available | 766 | Open in IMG/M |
3300009545|Ga0105237_11516756 | Not Available | 677 | Open in IMG/M |
3300009545|Ga0105237_11583999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
3300009551|Ga0105238_10513359 | Not Available | 1200 | Open in IMG/M |
3300009551|Ga0105238_11170963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 793 | Open in IMG/M |
3300009551|Ga0105238_11681534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
3300009553|Ga0105249_10132391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2382 | Open in IMG/M |
3300009553|Ga0105249_10145076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2279 | Open in IMG/M |
3300009553|Ga0105249_11248113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 814 | Open in IMG/M |
3300009553|Ga0105249_11771420 | Not Available | 690 | Open in IMG/M |
3300009553|Ga0105249_13480223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
3300009792|Ga0126374_10148449 | Not Available | 1416 | Open in IMG/M |
3300009792|Ga0126374_10367509 | Not Available | 993 | Open in IMG/M |
3300009792|Ga0126374_11330876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300010043|Ga0126380_10063393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2061 | Open in IMG/M |
3300010046|Ga0126384_11125551 | Not Available | 721 | Open in IMG/M |
3300010046|Ga0126384_11584081 | Not Available | 616 | Open in IMG/M |
3300010046|Ga0126384_12163916 | Not Available | 535 | Open in IMG/M |
3300010047|Ga0126382_11018610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2568 | 727 | Open in IMG/M |
3300010333|Ga0134080_10550022 | Not Available | 555 | Open in IMG/M |
3300010358|Ga0126370_10088753 | Not Available | 2103 | Open in IMG/M |
3300010359|Ga0126376_11112133 | Not Available | 799 | Open in IMG/M |
3300010360|Ga0126372_10605490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1052 | Open in IMG/M |
3300010362|Ga0126377_12889130 | Not Available | 554 | Open in IMG/M |
3300010371|Ga0134125_10400602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1522 | Open in IMG/M |
3300010371|Ga0134125_10510574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1331 | Open in IMG/M |
3300010371|Ga0134125_11295988 | Not Available | 795 | Open in IMG/M |
3300010371|Ga0134125_11296979 | Not Available | 795 | Open in IMG/M |
3300010371|Ga0134125_11566892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
3300010371|Ga0134125_12559073 | Not Available | 555 | Open in IMG/M |
3300010373|Ga0134128_10369950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1601 | Open in IMG/M |
3300010373|Ga0134128_10522009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1324 | Open in IMG/M |
3300010373|Ga0134128_12809819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
3300010375|Ga0105239_10985588 | Not Available | 969 | Open in IMG/M |
3300010375|Ga0105239_11184491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 880 | Open in IMG/M |
3300010375|Ga0105239_12083454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
3300010396|Ga0134126_12166813 | Not Available | 607 | Open in IMG/M |
3300010397|Ga0134124_10250510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1629 | Open in IMG/M |
3300010399|Ga0134127_10022522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4915 | Open in IMG/M |
3300010400|Ga0134122_10091230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2398 | Open in IMG/M |
3300010400|Ga0134122_10199906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1657 | Open in IMG/M |
3300010400|Ga0134122_10344068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1296 | Open in IMG/M |
3300010401|Ga0134121_10068505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2932 | Open in IMG/M |
3300010401|Ga0134121_10292080 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300010401|Ga0134121_13228966 | Not Available | 504 | Open in IMG/M |
3300010403|Ga0134123_10132473 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
3300010403|Ga0134123_10414144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 1240 | Open in IMG/M |
3300010403|Ga0134123_12984878 | Not Available | 542 | Open in IMG/M |
3300011119|Ga0105246_10026051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3816 | Open in IMG/M |
3300012206|Ga0137380_10461660 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300012208|Ga0137376_10603220 | Not Available | 950 | Open in IMG/M |
3300012209|Ga0137379_10005338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 12116 | Open in IMG/M |
3300012209|Ga0137379_10135683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2364 | Open in IMG/M |
3300012349|Ga0137387_11085578 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300012351|Ga0137386_10584008 | Not Available | 804 | Open in IMG/M |
3300012473|Ga0157340_1003350 | Not Available | 874 | Open in IMG/M |
3300012498|Ga0157345_1010858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
3300012951|Ga0164300_10063664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1506 | Open in IMG/M |
3300012955|Ga0164298_10055006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1931 | Open in IMG/M |
3300012955|Ga0164298_10664408 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300012957|Ga0164303_10058410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1746 | Open in IMG/M |
3300012957|Ga0164303_10090708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1486 | Open in IMG/M |
3300012957|Ga0164303_11096799 | Not Available | 574 | Open in IMG/M |
3300012960|Ga0164301_10021442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2902 | Open in IMG/M |
3300012961|Ga0164302_10003736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5294 | Open in IMG/M |
3300012984|Ga0164309_10915518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
3300012984|Ga0164309_11089264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 664 | Open in IMG/M |
3300012985|Ga0164308_10477377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
3300012985|Ga0164308_10608914 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300012985|Ga0164308_12051656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300012986|Ga0164304_11349604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300012986|Ga0164304_11416332 | Not Available | 571 | Open in IMG/M |
3300012987|Ga0164307_11550254 | Not Available | 560 | Open in IMG/M |
3300012988|Ga0164306_10040269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2756 | Open in IMG/M |
3300012988|Ga0164306_11271855 | Not Available | 620 | Open in IMG/M |
3300012989|Ga0164305_10066759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2181 | Open in IMG/M |
3300013100|Ga0157373_10179400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1491 | Open in IMG/M |
3300013100|Ga0157373_10204126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1393 | Open in IMG/M |
3300013100|Ga0157373_10248805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1257 | Open in IMG/M |
3300013102|Ga0157371_10508313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
3300013104|Ga0157370_11485926 | Not Available | 609 | Open in IMG/M |
3300013104|Ga0157370_11968566 | Not Available | 524 | Open in IMG/M |
3300013105|Ga0157369_10888103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
3300013105|Ga0157369_11423270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
3300013105|Ga0157369_11626082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
3300013105|Ga0157369_11696698 | Not Available | 642 | Open in IMG/M |
3300013296|Ga0157374_10601288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 1110 | Open in IMG/M |
3300013296|Ga0157374_11042074 | Not Available | 838 | Open in IMG/M |
3300013296|Ga0157374_11210698 | Not Available | 777 | Open in IMG/M |
3300013296|Ga0157374_11658915 | Not Available | 664 | Open in IMG/M |
3300013296|Ga0157374_12948305 | Not Available | 503 | Open in IMG/M |
3300013297|Ga0157378_10726040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
3300013306|Ga0163162_10502897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1342 | Open in IMG/M |
3300013306|Ga0163162_12487720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
3300013307|Ga0157372_11332408 | Not Available | 828 | Open in IMG/M |
3300013307|Ga0157372_11537003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
3300013307|Ga0157372_11556686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 761 | Open in IMG/M |
3300013307|Ga0157372_11607459 | Not Available | 748 | Open in IMG/M |
3300013307|Ga0157372_12000422 | Not Available | 666 | Open in IMG/M |
3300013307|Ga0157372_13382972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 508 | Open in IMG/M |
3300013308|Ga0157375_10436483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 1475 | Open in IMG/M |
3300013308|Ga0157375_12336882 | Not Available | 638 | Open in IMG/M |
3300013308|Ga0157375_12719336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
3300013308|Ga0157375_13769915 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300014326|Ga0157380_11636968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
3300014745|Ga0157377_10086451 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
3300014745|Ga0157377_10702987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 734 | Open in IMG/M |
3300014968|Ga0157379_10370419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1313 | Open in IMG/M |
3300014968|Ga0157379_10779990 | Not Available | 901 | Open in IMG/M |
3300014969|Ga0157376_10567360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1125 | Open in IMG/M |
3300015242|Ga0137412_10519759 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300015372|Ga0132256_100372645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
3300017792|Ga0163161_10123694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis | 1946 | Open in IMG/M |
3300017792|Ga0163161_11005144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 712 | Open in IMG/M |
3300017792|Ga0163161_11299537 | Not Available | 632 | Open in IMG/M |
3300017792|Ga0163161_11716750 | Not Available | 556 | Open in IMG/M |
3300018482|Ga0066669_11044004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
3300019877|Ga0193722_1028878 | Not Available | 1436 | Open in IMG/M |
3300019877|Ga0193722_1114546 | Not Available | 630 | Open in IMG/M |
3300020002|Ga0193730_1135469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
3300020002|Ga0193730_1151048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 614 | Open in IMG/M |
3300020069|Ga0197907_11400620 | Not Available | 568 | Open in IMG/M |
3300020070|Ga0206356_10808002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
3300020082|Ga0206353_11641085 | Not Available | 612 | Open in IMG/M |
3300021401|Ga0210393_10868722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → unclassified Frankiales → Frankineae bacterium MT45 | 733 | Open in IMG/M |
3300021403|Ga0210397_10155688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1600 | Open in IMG/M |
3300021404|Ga0210389_10304868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces gilvigriseus | 1248 | Open in IMG/M |
3300021475|Ga0210392_10234928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1293 | Open in IMG/M |
3300021475|Ga0210392_10631894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
3300022756|Ga0222622_10136703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1563 | Open in IMG/M |
3300024232|Ga0247664_1099898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
3300024254|Ga0247661_1026436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1028 | Open in IMG/M |
3300024254|Ga0247661_1079194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
3300024331|Ga0247668_1070902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 704 | Open in IMG/M |
3300024331|Ga0247668_1090600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300025885|Ga0207653_10018902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2170 | Open in IMG/M |
3300025885|Ga0207653_10039312 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300025885|Ga0207653_10123989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 932 | Open in IMG/M |
3300025900|Ga0207710_10166968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces angustmyceticus | 1075 | Open in IMG/M |
3300025900|Ga0207710_10248034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 890 | Open in IMG/M |
3300025900|Ga0207710_10481817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 643 | Open in IMG/M |
3300025903|Ga0207680_10213869 | Not Available | 1319 | Open in IMG/M |
3300025905|Ga0207685_10014405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2475 | Open in IMG/M |
3300025905|Ga0207685_10125687 | Not Available | 1132 | Open in IMG/M |
3300025905|Ga0207685_10126864 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300025906|Ga0207699_10342659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
3300025908|Ga0207643_10231086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1134 | Open in IMG/M |
3300025909|Ga0207705_10242046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1374 | Open in IMG/M |
3300025911|Ga0207654_10168371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1421 | Open in IMG/M |
3300025914|Ga0207671_11015848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
3300025916|Ga0207663_11268686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 593 | Open in IMG/M |
3300025916|Ga0207663_11472404 | Not Available | 548 | Open in IMG/M |
3300025917|Ga0207660_10157915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1747 | Open in IMG/M |
3300025917|Ga0207660_10498194 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300025918|Ga0207662_10021450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 3692 | Open in IMG/M |
3300025921|Ga0207652_10200296 | Not Available | 1797 | Open in IMG/M |
3300025921|Ga0207652_10650743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 942 | Open in IMG/M |
3300025924|Ga0207694_11238628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
3300025926|Ga0207659_11629636 | Not Available | 550 | Open in IMG/M |
3300025927|Ga0207687_10961882 | Not Available | 732 | Open in IMG/M |
3300025928|Ga0207700_11903717 | Not Available | 521 | Open in IMG/M |
3300025929|Ga0207664_11175853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 684 | Open in IMG/M |
3300025929|Ga0207664_11349314 | Not Available | 633 | Open in IMG/M |
3300025935|Ga0207709_10795917 | Not Available | 763 | Open in IMG/M |
3300025936|Ga0207670_10640996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 875 | Open in IMG/M |
3300025938|Ga0207704_10414556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1066 | Open in IMG/M |
3300025938|Ga0207704_10775489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
3300025940|Ga0207691_10056849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3563 | Open in IMG/M |
3300025940|Ga0207691_10496214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1037 | Open in IMG/M |
3300025941|Ga0207711_10777253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 892 | Open in IMG/M |
3300025942|Ga0207689_10020732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 5527 | Open in IMG/M |
3300025942|Ga0207689_11749100 | Not Available | 514 | Open in IMG/M |
3300025944|Ga0207661_10534585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1073 | Open in IMG/M |
3300025945|Ga0207679_11506810 | Not Available | 617 | Open in IMG/M |
3300025949|Ga0207667_11082439 | Not Available | 785 | Open in IMG/M |
3300025960|Ga0207651_11399454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
3300025960|Ga0207651_11791743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 553 | Open in IMG/M |
3300025961|Ga0207712_10326614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1268 | Open in IMG/M |
3300025972|Ga0207668_10099390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2159 | Open in IMG/M |
3300026023|Ga0207677_11774855 | Not Available | 572 | Open in IMG/M |
3300026035|Ga0207703_10270701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1539 | Open in IMG/M |
3300026041|Ga0207639_10116633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2186 | Open in IMG/M |
3300026041|Ga0207639_10129299 | Not Available | 2088 | Open in IMG/M |
3300026041|Ga0207639_11737816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300026075|Ga0207708_10919067 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300026078|Ga0207702_11072948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 799 | Open in IMG/M |
3300026116|Ga0207674_10027718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5987 | Open in IMG/M |
3300026116|Ga0207674_10065383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3666 | Open in IMG/M |
3300026118|Ga0207675_100021016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 6085 | Open in IMG/M |
3300026118|Ga0207675_102206188 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300026121|Ga0207683_10015016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6591 | Open in IMG/M |
3300026121|Ga0207683_10237800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1661 | Open in IMG/M |
3300027002|Ga0209110_1012673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
3300027050|Ga0209325_1005979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1293 | Open in IMG/M |
3300027100|Ga0208862_103578 | Not Available | 572 | Open in IMG/M |
3300027725|Ga0209178_1388085 | Not Available | 528 | Open in IMG/M |
3300027765|Ga0209073_10337588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium aerolatum | 605 | Open in IMG/M |
3300027775|Ga0209177_10127518 | Not Available | 839 | Open in IMG/M |
3300028072|Ga0247675_1013338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1163 | Open in IMG/M |
3300028072|Ga0247675_1018811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 989 | Open in IMG/M |
3300028146|Ga0247682_1054365 | Not Available | 724 | Open in IMG/M |
3300028146|Ga0247682_1057719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 703 | Open in IMG/M |
3300028379|Ga0268266_11201897 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300028379|Ga0268266_11402894 | Not Available | 674 | Open in IMG/M |
3300028379|Ga0268266_11936079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 563 | Open in IMG/M |
3300028381|Ga0268264_12402569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
3300028709|Ga0307279_10087352 | Not Available | 564 | Open in IMG/M |
3300028720|Ga0307317_10220013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
3300028768|Ga0307280_10085127 | Not Available | 1034 | Open in IMG/M |
3300028768|Ga0307280_10300956 | Not Available | 585 | Open in IMG/M |
3300028784|Ga0307282_10123675 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
3300028784|Ga0307282_10147895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1111 | Open in IMG/M |
3300028784|Ga0307282_10486226 | Not Available | 599 | Open in IMG/M |
3300028787|Ga0307323_10057459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1376 | Open in IMG/M |
3300028791|Ga0307290_10167144 | Not Available | 806 | Open in IMG/M |
3300028791|Ga0307290_10383409 | Not Available | 514 | Open in IMG/M |
3300028793|Ga0307299_10204992 | Not Available | 742 | Open in IMG/M |
3300028793|Ga0307299_10374985 | Not Available | 533 | Open in IMG/M |
3300028799|Ga0307284_10429153 | Not Available | 539 | Open in IMG/M |
3300028807|Ga0307305_10136961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1130 | Open in IMG/M |
3300028819|Ga0307296_10842683 | Not Available | 500 | Open in IMG/M |
3300028828|Ga0307312_10032369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3055 | Open in IMG/M |
3300028828|Ga0307312_10600224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 728 | Open in IMG/M |
3300028828|Ga0307312_11121384 | Not Available | 520 | Open in IMG/M |
3300028884|Ga0307308_10028670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2581 | Open in IMG/M |
3300031421|Ga0308194_10329874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
3300031720|Ga0307469_11453628 | Not Available | 655 | Open in IMG/M |
3300031720|Ga0307469_11621614 | Not Available | 622 | Open in IMG/M |
3300031720|Ga0307469_12437251 | Not Available | 511 | Open in IMG/M |
3300031740|Ga0307468_100519603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
3300031820|Ga0307473_11536213 | Not Available | 506 | Open in IMG/M |
3300031996|Ga0308176_11223671 | Not Available | 797 | Open in IMG/M |
3300032074|Ga0308173_10617019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 984 | Open in IMG/M |
3300032174|Ga0307470_10952859 | Not Available | 679 | Open in IMG/M |
3300032174|Ga0307470_11518242 | Not Available | 557 | Open in IMG/M |
3300032180|Ga0307471_100265278 | Not Available | 1781 | Open in IMG/M |
3300032180|Ga0307471_100666351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1204 | Open in IMG/M |
3300032180|Ga0307471_101820939 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300032205|Ga0307472_100179242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1585 | Open in IMG/M |
3300032205|Ga0307472_100462969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 1081 | Open in IMG/M |
3300032205|Ga0307472_102426607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
3300032783|Ga0335079_10023468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 7065 | Open in IMG/M |
3300032896|Ga0335075_10821558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 867 | Open in IMG/M |
3300032898|Ga0335072_10517490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1230 | Open in IMG/M |
3300033004|Ga0335084_11293263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 726 | Open in IMG/M |
3300033412|Ga0310810_11328602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
3300034817|Ga0373948_0106278 | Not Available | 666 | Open in IMG/M |
3300034818|Ga0373950_0094102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 639 | Open in IMG/M |
3300034818|Ga0373950_0111174 | Not Available | 598 | Open in IMG/M |
3300034819|Ga0373958_0132229 | Not Available | 612 | Open in IMG/M |
3300034820|Ga0373959_0070960 | Not Available | 787 | Open in IMG/M |
3300034820|Ga0373959_0141411 | Not Available | 603 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.34% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.38% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.38% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.12% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.12% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.61% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.35% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.32% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.55% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.03% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.77% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.52% | |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.26% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.26% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.26% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.26% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.26% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.26% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF025 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_01899950 | 2124908016 | WHRVALDPGFHCVTTHSNWGFMGFQPVRRTRTVMLMVLT | |
OU_00191940 | 2124908016 | PDAMKPGIHGVRTRWIRGFMAFQLARRTRAVRLMVPE | |
N57_01723330 | 2170459013 | Grass Soil | MKIGPLPDALKPGFQCARTHWNRGFMAFRLVRRTRAAVLTVPM |
4MG_05274790 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MKPGIHCVRTHWILGFIAFQLARRARTLMLMIPGWPSLD |
FD1_00095370 | 2170459024 | Grass Soil | MEPGFHCVTTHWIRDFMAFQLARRTRTAMLMVPVCPESV |
JGI10216J12902_1025409731 | 3300000956 | Soil | MEPGFHCVRTHWIRGFMAFRLAGRTRTVLLMVPV* |
JGI10216J12902_1186673902 | 3300000956 | Soil | MTIRLLPDALEPGFHCVRTRWIWGFTTLQLARRTRTVLLVVLV* |
JGI12627J18819_104095402 | 3300001867 | Forest Soil | PDALDSGFHCVRTPWIRGFMAFRLARSTRTAMLMVPV* |
Ga0062595_1015457321 | 3300004479 | Soil | MLFSAPLKLIMKIGPLPDALKPDIHCVRTQWIRGFIAFLLARRTETLMLMVPV* |
Ga0070683_1000575512 | 3300005329 | Corn Rhizosphere | VLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRNEP* |
Ga0070683_1003429821 | 3300005329 | Corn Rhizosphere | MPDAMESDIHGVRTHWIRGFMAFQLARCIRTVVLTVPVWPESGF |
Ga0070683_1013486271 | 3300005329 | Corn Rhizosphere | MAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTVLLMVPM* |
Ga0070690_1008531221 | 3300005330 | Switchgrass Rhizosphere | GRLPDAVEPGYHGVRTRWIRGFMTFHLARRTQTVRLTVPV* |
Ga0070670_1007299133 | 3300005331 | Switchgrass Rhizosphere | MKPDIHGVGTHWIRGFMAFRLARRTRTVMLMVPVCPESVF* |
Ga0066388_1004049233 | 3300005332 | Tropical Forest Soil | IMKIGPLPDAVKPGFHCVRTHWIGGFTAFRLARRSRTVVLVMSA* |
Ga0068869_1001538961 | 3300005334 | Miscanthus Rhizosphere | IGLLPDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT* |
Ga0070666_104417253 | 3300005335 | Switchgrass Rhizosphere | IMTIGPLPDAMDPGFHGARTHWIRGFMTFRLVRRTRAVR* |
Ga0070682_1006358692 | 3300005337 | Corn Rhizosphere | MKIGPLPDVMDSGFHGVRTPWIRGFMAFRLARRTQTAMLMVPA* |
Ga0070682_1006880361 | 3300005337 | Corn Rhizosphere | LIMAIGLRSDALKRDIHCVRTHWIRGFMTFELARRTRIVLLMVPM* |
Ga0068868_1002779193 | 3300005338 | Miscanthus Rhizosphere | VDHEDRPAAGRLPDALEPGIHGVGTRWIRGFMAFQLARYTRTALLTVPE* |
Ga0068868_1002832951 | 3300005338 | Miscanthus Rhizosphere | IGPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA* |
Ga0070660_1010337811 | 3300005339 | Corn Rhizosphere | RRWPRPDALKPDIHGVRTHWIPGFMAFQLARRSRSVVLTVLAVA* |
Ga0070661_1006397341 | 3300005344 | Corn Rhizosphere | RPPDALDPGFHGVRTPWIRGFMAFQAGRRTRTVMLVVPT* |
Ga0070671_1008322261 | 3300005355 | Switchgrass Rhizosphere | ANVDHEDRPAAGRLPDALEPGIHGVGTRWIRGFMAFQLARYTRTALLTVPE* |
Ga0070671_1015564781 | 3300005355 | Switchgrass Rhizosphere | MAIGLRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVP |
Ga0070674_1005507001 | 3300005356 | Miscanthus Rhizosphere | MPAARLKPDIHCVRTHWIRGFIAFQLARRTQNVLLMVPVA* |
Ga0070673_1003406442 | 3300005364 | Switchgrass Rhizosphere | SAAGRLPDAVEPGFHGVGTRWIRGFMTFQLTRRTQTVGLTVPV* |
Ga0070673_1010210461 | 3300005364 | Switchgrass Rhizosphere | LQLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA* |
Ga0070659_1001328221 | 3300005366 | Corn Rhizosphere | MKPGFHCVRTHWIRGFMAFQLVRRARTVMLMVSMCPESGF |
Ga0070659_1014141992 | 3300005366 | Corn Rhizosphere | VLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT* |
Ga0070667_1004264001 | 3300005367 | Switchgrass Rhizosphere | VDHEDRPAAGRLPDALEPGIHGVGTHWIRGFMAFQLARYTRTVLLTVPE* |
Ga0070709_113575241 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NALDPGFHCVRTHWIRGFMAFDLARRIRTVMLMVPVCPESGL* |
Ga0070709_114814521 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PRPDALKPGFHGVRTHWIRGFMAFELARRTWIALLMVPV* |
Ga0070714_1010399421 | 3300005435 | Agricultural Soil | MKIGPLPDVMDSGFHGVRTHWIRGFMAFRLARRTRTAMLMVPV* |
Ga0070714_1011959902 | 3300005435 | Agricultural Soil | MAIGLPGRTNALKPCIHGVRAHWIRGFMAFQMTRRTRTVVLMVPM* |
Ga0070714_1016190461 | 3300005435 | Agricultural Soil | MAIGLRPDALKPYIHCVRAPRGFMAFQMARRTRTVVLMVPM* |
Ga0070713_1017375411 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIGLRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVPM* |
Ga0070710_101099352 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGPLPDALDPGFHGVNAVNPGFMAFQMRWRTRIVRRMVLE* |
Ga0070681_101796921 | 3300005458 | Corn Rhizosphere | VLKPGIHGVRTRWIRGFMAFRLVRRTRIVMLMVPACPESG |
Ga0070681_101908053 | 3300005458 | Corn Rhizosphere | MAIGLRPDALKPYIHCVRAPRGFMAFQMARRTRTVVLMVPM |
Ga0073909_100511963 | 3300005526 | Surface Soil | MKPGIHCVRTRWIRGFMAFELARSRQTVMLMVPV* |
Ga0070679_1003896031 | 3300005530 | Corn Rhizosphere | RPPDALDPGFHGVRTPWIRGFTASKLARRTRTVMLVVPT* |
Ga0070684_1017723821 | 3300005535 | Corn Rhizosphere | GRLPDAVEPGFHGVRTRWIRGFMTFHLARRTQTVRLTVPV* |
Ga0068853_1000307011 | 3300005539 | Corn Rhizosphere | MAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTGLLMVPV* |
Ga0070672_1002429161 | 3300005543 | Miscanthus Rhizosphere | PDAMKPGFHGVGTHWIRGFMAFRLVRRTRTKTPMVPV* |
Ga0070672_1012970071 | 3300005543 | Miscanthus Rhizosphere | PDALEPGIHGVGTRWIRGFMAFQLARYTRTVLLTVPE* |
Ga0070695_1003106373 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | SAACRTHQPAAGRTPDALNPDIDGVLTHWIRGFMPFQLARYTRSVMPMVPV* |
Ga0070695_1016905851 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MATGLRSEALKRDIHCVRTHWIRGFMTFELARRTRIVLLMVPM* |
Ga0070665_1003470111 | 3300005548 | Switchgrass Rhizosphere | LPDAVEPGFHGVGTRWIRGFMTFQLTRRTQTVGLTVPV* |
Ga0070665_1003862582 | 3300005548 | Switchgrass Rhizosphere | MEPDIHGVRTHWIRGFMAFWLARRTRIVRLVVSA* |
Ga0070665_1013325412 | 3300005548 | Switchgrass Rhizosphere | MKPGFHGVGTHWIRGFMAFWLARRTRTKMPMVPV* |
Ga0066695_106454242 | 3300005553 | Soil | PDGLDPAFHCVSLVRTRWIRGFIAFRLAQRTRTVMLMVPV* |
Ga0068855_1002815492 | 3300005563 | Corn Rhizosphere | MDSGFHGVRTDWIRSFMPFHLVRHARTVMLMVPA* |
Ga0068855_1007315331 | 3300005563 | Corn Rhizosphere | MKPGFHCVRTHWIRGFMAFQRARRTRIVLLAVPV* |
Ga0068855_1013780111 | 3300005563 | Corn Rhizosphere | RWPRPDALKPDIHGVRTHWIPGFMAFQLARRGRSVVLTVLVWA* |
Ga0068855_1016129152 | 3300005563 | Corn Rhizosphere | LIMAIGLRSDALKPDIHCVRTHWIRGVMTFELARRTRIVLLMVPM* |
Ga0068855_1021218631 | 3300005563 | Corn Rhizosphere | LIVTIGPLPDAMEPGFHGLRTPWIRGFMPFQLAPRARIVMLMV* |
Ga0070664_1000590865 | 3300005564 | Corn Rhizosphere | VKPGVQCVKTHWIRGFIAFRLARHTRTVMLMVPV* |
Ga0070664_1001099511 | 3300005564 | Corn Rhizosphere | GRLPDAVEPGFHGVGTRWIRGFMTFQLTRRTQTVGLTVPV* |
Ga0070664_1001498923 | 3300005564 | Corn Rhizosphere | PDVLKPDIQCVRTHWIRGFMAFRVARRTRIVVLIGSV* |
Ga0066693_100845022 | 3300005566 | Soil | MTIGLPPDALDPVFHGLRTRWNRDFMAFQLARRTRTVMLMTAV* |
Ga0068856_1011118292 | 3300005614 | Corn Rhizosphere | MEPGIHGVRTQWIRGFMAFRLVRRIRTVMLMVLV* |
Ga0068856_1017246742 | 3300005614 | Corn Rhizosphere | LIVTIGPLPDAMEPGFHGVRTPWIRRFMPFQLAPRARIVMLMV* |
Ga0068856_1021777221 | 3300005614 | Corn Rhizosphere | VPNALDSGIHGARTHWIRGFMPFRLARRTQIVRLMVLA* |
Ga0068859_1004658612 | 3300005617 | Switchgrass Rhizosphere | MKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTRAVMLMVSVS* |
Ga0068864_1026869031 | 3300005618 | Switchgrass Rhizosphere | PDALDPGFHCVRTPWIRGFMAFRLARRTRIVLLMVPM* |
Ga0068866_100537393 | 3300005718 | Miscanthus Rhizosphere | MEPGFHCVRTHWIRGFMAFQLARRVRVVVLEIREWLL |
Ga0068866_101852351 | 3300005718 | Miscanthus Rhizosphere | VDAVKSGFHCLIAHWIRGFMTFQLAWRTRIVLLMVSV* |
Ga0068861_1002301271 | 3300005719 | Switchgrass Rhizosphere | ALNPGFHGVRTPWIQGFMAFQLVRCARIVRLMVPA* |
Ga0068851_100610083 | 3300005834 | Corn Rhizosphere | MAIGLRSDALKRDIHCVRTHWIRGVMTFELARRTRIVLLMVPM* |
Ga0068870_103786122 | 3300005840 | Miscanthus Rhizosphere | MDPGFHGVRTHWIRGFMAFRSDRRARMVMLTVPV* |
Ga0068863_1026767772 | 3300005841 | Switchgrass Rhizosphere | LKPDIQCVRTHWIRGFMAFQLARRTRIVVLMGSV* |
Ga0068858_1003890491 | 3300005842 | Switchgrass Rhizosphere | LKPDIQCVRTHWIRGFMAFQLARHTRIVMLMGSA* |
Ga0068858_1022369561 | 3300005842 | Switchgrass Rhizosphere | LIMMIGPLPDAMKPGFHCVRTHWIRGFIAFRLVRRTSTVVLMVPA* |
Ga0068858_1023613662 | 3300005842 | Switchgrass Rhizosphere | MKPGFHCVRTHWIRGFTTFQLARRTWTVILTVLV* |
Ga0070717_102441881 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPRIHGVGTHWIPGFMAFQSTRRTRIAMLMVPV* |
Ga0070717_115146813 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPGIHCVRTHWIRGFMAFQLGPGRRIVRLMVLV* |
Ga0070715_100309472 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPGFHGVRTPWIRGFMAFRLARRTRTAMLMVPA* |
Ga0070716_1001343913 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPGFHGVGTHWIRGFMAFRLVRRTRTKTPMVPV* |
Ga0070716_1016925672 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIMTIDLLLDALELGFHCARTHWIRGFMAFLLARRTRTAMLMVSV* |
Ga0070712_1012967091 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AGRLPDGVKPGFHGARTHWIRGFMAFRPARSTRVVMLVVPV* |
Ga0070712_1014122932 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ALKPDIHCVRAHWIRGFMAFQMARRTRTVLLMVPM* |
Ga0097621_1002566481 | 3300006237 | Miscanthus Rhizosphere | DALKPDIHGVRTPWIRGFMAFQLARRRRSVVLTVLAVA* |
Ga0068871_1022946971 | 3300006358 | Miscanthus Rhizosphere | DVLKPDIQCVRTHWIRGFMAFRVARRTRIVVLIGSV* |
Ga0079222_100335892 | 3300006755 | Agricultural Soil | MEPGFHGARTPWIRGFMAFQLARRARIVMLMVPT* |
Ga0079222_102591252 | 3300006755 | Agricultural Soil | VESGIHGVRTPWIRGFMTFQMARRTQTVLLVVPV* |
Ga0079222_107019001 | 3300006755 | Agricultural Soil | RPPDVLKPGIHGVRTHWIRGFMAFRLVRRTRAVRLTVPP* |
Ga0079221_100959112 | 3300006804 | Agricultural Soil | MEPGFHGARTPWIRGFMAFHLARRARIVMLMVPT* |
Ga0079221_104788232 | 3300006804 | Agricultural Soil | LPDALDPRFHRVRTPWIRGFMAFRLARRIRIVMLMIPV* |
Ga0079221_113756231 | 3300006804 | Agricultural Soil | MKPDIHGVRAHWIRGFMAFQLARRTRPAVLMVSAWLTRIL |
Ga0079220_100813423 | 3300006806 | Agricultural Soil | MKPGIHCARTHWIRGFIAFRLVRRIRIVMLTMLA* |
Ga0079220_101661583 | 3300006806 | Agricultural Soil | MLNMTIGLLPDAMKPGIHCVTTHWIRGFMAFQLAKCTRTVVLTVPV* |
Ga0079220_110467902 | 3300006806 | Agricultural Soil | MAIGLWPDALKLDIHCVRAHWIRGFSAFQLARRTRIVLLMVPV* |
Ga0075425_1005716282 | 3300006854 | Populus Rhizosphere | MEPDIHGVRTHWILGFMAFLAARRTGIVRLMVSA* |
Ga0075434_1009118321 | 3300006871 | Populus Rhizosphere | LKPDIQCVRTHWIRGFMAFQLARTTRIVVLMGSA* |
Ga0075434_1016296322 | 3300006871 | Populus Rhizosphere | LIMTIRLLPDALEPGFHCVRTRWIRGFMTFQRAPRTRITMLMVPV* |
Ga0075434_1020146001 | 3300006871 | Populus Rhizosphere | PLSDALDPGLHCVRTHWTRGFMTFRPARRTRIVLLMVPV* |
Ga0068865_1001856841 | 3300006881 | Miscanthus Rhizosphere | MAIGLRSDALKRDIHCVRTHWIRGFMTFELARRTRIVLLMVPM* |
Ga0068865_1004518061 | 3300006881 | Miscanthus Rhizosphere | IGPLPDAMDPGIHGVRTPWIRGSMTFQLARRTRIVRLTVPA* |
Ga0068865_1004657403 | 3300006881 | Miscanthus Rhizosphere | LKPDIQCARTHWIRGFIAFQLARRTRTVLLMVPM* |
Ga0068865_1021332181 | 3300006881 | Miscanthus Rhizosphere | LPDAVEPGFHGVRTRWIRGFMTFHLARRTQTVRLTVPV* |
Ga0075426_104107092 | 3300006903 | Populus Rhizosphere | MEPGIHGVRTQWIRGFMAFRLVRRIRTVMLMVLM* |
Ga0075424_1016625511 | 3300006904 | Populus Rhizosphere | MMTGPLPDAMKPGTHCVLTHWIRGFIAFQLTRRTRTVLLAVLV* |
Ga0075436_1013664651 | 3300006914 | Populus Rhizosphere | MPDAVDSGFHCARTQWIRAFMLFRLVRRIRTVMLMV |
Ga0079219_101704131 | 3300006954 | Agricultural Soil | VLIMTIGLLPDVLKPGIHCARTHWIRGFTTFQLARRTRTVMLMVPV* |
Ga0079219_119965411 | 3300006954 | Agricultural Soil | PNALDPGFHWVRAHWIRGFMAFQLARHTRIVILAVPV* |
Ga0079219_120297852 | 3300006954 | Agricultural Soil | LPHTSGVAPDALDRGFHCAGTHWIRGFMAFPMVRPIRTVMLTVPV* |
Ga0105244_101423661 | 3300009036 | Miscanthus Rhizosphere | DAVDQGFHCARTQWIRGFMLFRLVRRIRTMMLMVPV* |
Ga0105244_105140431 | 3300009036 | Miscanthus Rhizosphere | MDPGFHGVRTPWIRGFMAFRLARRTRTAMLMVPVEPESVSEIVPPAR |
Ga0105250_101410561 | 3300009092 | Switchgrass Rhizosphere | MKPGFHCVRTHWIRGFIAFRLVRRTSTVVLMVPA* |
Ga0105240_104596122 | 3300009093 | Corn Rhizosphere | MEPGFHCVRAHWIRGFIAFQLARRTRTVMLMVLA* |
Ga0105240_119236991 | 3300009093 | Corn Rhizosphere | MDPGFHSARTRWARGFMTFQLARRTRIVMLMVPA* |
Ga0105245_101026682 | 3300009098 | Miscanthus Rhizosphere | VNAALGPLPNALDPGFQCVRTHWIRGFMAFRLARRTRTVMLTVPE* |
Ga0105245_109123931 | 3300009098 | Miscanthus Rhizosphere | MDPGFHGVRTPWIRGFMAFRLARRTQTAMLMVPT* |
Ga0105245_110292942 | 3300009098 | Miscanthus Rhizosphere | MPDVMKPDIHCVRTHWIRGFMAFQMARRTPVVMLMVPV* |
Ga0105245_110666691 | 3300009098 | Miscanthus Rhizosphere | MPRGLLPDALKPGFQCARTQWIRGFMAFQLARRTRTVMLMVPM* |
Ga0105245_111173441 | 3300009098 | Miscanthus Rhizosphere | GPPDALEPGFHCVRAHWIRGFMAFELARRTRTVRLMMSA* |
Ga0105245_117904061 | 3300009098 | Miscanthus Rhizosphere | LPDVMKPGFHCVRTQWIRGFIAFQLARRIRIVMLMMPV* |
Ga0105245_121464912 | 3300009098 | Miscanthus Rhizosphere | MKPGIHCARTHWIRGFMAFQLARRTRILMLMVPV* |
Ga0105247_100450471 | 3300009101 | Switchgrass Rhizosphere | MKPGIRGVRTRWIRGFMAFQLARRTRAVRLMVAEWLVLLAGLLR |
Ga0105247_103806353 | 3300009101 | Switchgrass Rhizosphere | PNALDSGIHGARTHWIRGFMPFRLARRTQIVRLMVLA* |
Ga0105247_107995301 | 3300009101 | Switchgrass Rhizosphere | LIVTIGPLPDAMEPGFHGVRTPWIRGFMPFQLAPRARIVMLMV* |
Ga0105243_101540451 | 3300009148 | Miscanthus Rhizosphere | KLGFHCVRAHWIRGFMAFHLVRRTRIVMLMMPVCP* |
Ga0105243_101825441 | 3300009148 | Miscanthus Rhizosphere | GRLPDVMPDVMKPDIHCVRTRWIRGFMAFQMARRTPVVMLVVLM* |
Ga0105243_102026981 | 3300009148 | Miscanthus Rhizosphere | LLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT* |
Ga0105243_106435982 | 3300009148 | Miscanthus Rhizosphere | LKPRIHGLRTPWIRGFMTFQLVRRTRIAMLMVPV* |
Ga0105243_123613612 | 3300009148 | Miscanthus Rhizosphere | MAIGLRSDALKPDIHCVRTHWIRGVMTFELARRTRIVLLMVPM* |
Ga0075423_106458251 | 3300009162 | Populus Rhizosphere | MDPGIHGVRTPWIQGFMTFQLARRVRVVILEIREWLLG |
Ga0075423_112743582 | 3300009162 | Populus Rhizosphere | RLPDALEPGIHGAGTHWIRGFMAFQLARYTRTVLLTVPE* |
Ga0105241_108064291 | 3300009174 | Corn Rhizosphere | LPDAVKPGIQCVRTPWIRGFMTFLRARHARIVMLMVPAWSGGV* |
Ga0105242_100340422 | 3300009176 | Miscanthus Rhizosphere | MKPGFHGVRTHWIRGFMAFQLARRTPVAMLMVPV* |
Ga0105248_103767281 | 3300009177 | Switchgrass Rhizosphere | MAIGLRPDALKPDIHCVRTHWIRGLMRFELARRTRIVLLMVPM* |
Ga0105248_126669581 | 3300009177 | Switchgrass Rhizosphere | DAVKLGFHCARTHWIRGFMAFQLAQRTRTVRLTVPM* |
Ga0105237_104941021 | 3300009545 | Corn Rhizosphere | VLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQPPRRTRAVMLMV |
Ga0105237_106847441 | 3300009545 | Corn Rhizosphere | RTAMEPGIHCVRAHWIPGFMTFRRVRHARTVMLMVPA* |
Ga0105237_111982772 | 3300009545 | Corn Rhizosphere | MKPGFHCVRTYWIRGFMAFQRARRTRIVLLAVPV* |
Ga0105237_115167562 | 3300009545 | Corn Rhizosphere | MEPGIHCVTAHWNRGFIAFQLARRTRIVMLMVPM* |
Ga0105237_115839991 | 3300009545 | Corn Rhizosphere | MPAGRLPDALKPDIQCARTHWIRGFIAFQLARSTRTVLLMVPM* |
Ga0105238_105133591 | 3300009551 | Corn Rhizosphere | MEPAFHCARTHWIRGFMAFLLARRTLTAMLMVSV* |
Ga0105238_111709632 | 3300009551 | Corn Rhizosphere | MKPGFHGVGTHWIRGFMAFRLARRTRTKMPMVPV* |
Ga0105238_116815343 | 3300009551 | Corn Rhizosphere | MDPGFHGVGTHWIRGFMAFRSDRRARMVMLTVPV* |
Ga0105249_101323912 | 3300009553 | Switchgrass Rhizosphere | MKPGFRGVGTHWIRGFMAFWLARRTRTKMPMVPV* |
Ga0105249_101450764 | 3300009553 | Switchgrass Rhizosphere | MEPGFHCVGTHWIQGFFTFRLVMRTRIVMLMVPV* |
Ga0105249_112481131 | 3300009553 | Switchgrass Rhizosphere | PDAMEPDIHGVRTHWIRGFMAFWLARRTRIVRLVVSA* |
Ga0105249_117714201 | 3300009553 | Switchgrass Rhizosphere | LRPQPDALDPGFHGARTHWIRGFMTFKLARRTRIVMLMVPA* |
Ga0105249_134802231 | 3300009553 | Switchgrass Rhizosphere | LIMAIGLRSDALKPDIQCARTHWIRGFIAFQLARSTRTVLLMVPM* |
Ga0126374_101484491 | 3300009792 | Tropical Forest Soil | MKPGIHYARTQCIPGFMTFLLARRVRIVMLMVPV* |
Ga0126374_103675091 | 3300009792 | Tropical Forest Soil | ASNARPNALDPGFHYVRAHWIRGFMPFQLARRTPIARLTVLA* |
Ga0126374_113308761 | 3300009792 | Tropical Forest Soil | VKPDIHRVSTHWIRDFITIHLAPRTRNVMLMVPA* |
Ga0126380_100633933 | 3300010043 | Tropical Forest Soil | MHWNRVFIAFGPLPDAVKPGFHCARTHWIRGFIAFQLARGTRIVRLMVPV* |
Ga0126384_111255511 | 3300010046 | Tropical Forest Soil | MSVMTIDLLTAAVKPGFHCVGTHWIRGFMAFQPARRTRIVVLMVSVRP* |
Ga0126384_115840811 | 3300010046 | Tropical Forest Soil | MLIMKMGPPPNAMKPGFHCVRAHWIRGFITFQLARRTRTVLLVVPA* |
Ga0126384_121639161 | 3300010046 | Tropical Forest Soil | MKPGFHCVRTHWIWGFIAFQLARRTRIVMLTILA* |
Ga0126382_110186102 | 3300010047 | Tropical Forest Soil | NALNPGFHCARTHWIRDFTAFRLARRTRTMLLMVPV* |
Ga0134080_105500221 | 3300010333 | Grasslands Soil | LPDAMKPGFHCVRTHWIRGFMTFQLVRRTRSVMLMVPE* |
Ga0126370_100887532 | 3300010358 | Tropical Forest Soil | MDSGFHCVRTHWIRGFITIHLAPRTRNVMLMVPA* |
Ga0126376_111121331 | 3300010359 | Tropical Forest Soil | MKPGIHYARTQCIPGFMTFLLARRARIVMLMVPV* |
Ga0126372_106054902 | 3300010360 | Tropical Forest Soil | MPDAMKPDIHCVRTHWIRGFITIHLAPRTRNVMLMVSA* |
Ga0126377_128891301 | 3300010362 | Tropical Forest Soil | MKPDFQCVRTHWNRDFMTFQVVQRTRITVLMVPT* |
Ga0134125_104006021 | 3300010371 | Terrestrial Soil | MKPGFHCVRTNWIRGFIVFRRVRHIGTVMLVVVP* |
Ga0134125_105105742 | 3300010371 | Terrestrial Soil | MKPGIHCARTHWIRGFIAFQLARRTRTAMLMVPV* |
Ga0134125_112959881 | 3300010371 | Terrestrial Soil | PRTVPNALDSGIHGARTHWIRGFMPFRLARRTQIVRLMVLA* |
Ga0134125_112969792 | 3300010371 | Terrestrial Soil | GVVKPGFHGVRTHWIRGSMTFQLVRRTQIALLMVPV* |
Ga0134125_115668922 | 3300010371 | Terrestrial Soil | MDPGIHGVRTPWIRGFKTFQLARRTRIVRLMVPV* |
Ga0134125_125590731 | 3300010371 | Terrestrial Soil | MKPGFHCVRTHWIRGFIAFRLVRRTSIVVLMVPT* |
Ga0134128_103699502 | 3300010373 | Terrestrial Soil | MDSGFHGVRTDWIRGFMPFHLVRHARTVMLMVPA* |
Ga0134128_105220091 | 3300010373 | Terrestrial Soil | MKPGIHCARTHWIRGFIAFQRARRIRIVMLMVPV* |
Ga0134128_128098192 | 3300010373 | Terrestrial Soil | DALDPGFHGVRTPWIRGFMAFQLARRTRIVRLMVPV* |
Ga0105239_109855882 | 3300010375 | Corn Rhizosphere | MKPGIHCVRTHWIRGFMAFLLARRTLTAMLMVSV* |
Ga0105239_111844911 | 3300010375 | Corn Rhizosphere | LLPDAMEPAFHCARTHWIRGFMAFLLARRTRTAMLMVPV* |
Ga0105239_120834541 | 3300010375 | Corn Rhizosphere | NAMKLGFHGVRTPWIRGFMAFRLARSTRTAMLMVPV* |
Ga0134126_121668131 | 3300010396 | Terrestrial Soil | VLKPGIHGVRTRWIRGFMAFRLVRRTRIVMLMVPA |
Ga0134124_102505101 | 3300010397 | Terrestrial Soil | MKIGPLPEALDPGFHCVRAHWIRGFMAFRLVRRTRIVTLMVPV* |
Ga0134127_100225225 | 3300010399 | Terrestrial Soil | MKIGPLPDVMDSWFHGVRTHWIRGFMAFRLARRTRTAMLMVPA* |
Ga0134122_100912301 | 3300010400 | Terrestrial Soil | MKPEIQCARTHWIRGFMPFRLVRRTLTVMPMVPT* |
Ga0134122_101999063 | 3300010400 | Terrestrial Soil | MEPGIHCVTAHWNRGFIAFQLARRTRIVMLMIPV* |
Ga0134122_103440681 | 3300010400 | Terrestrial Soil | VDHEDRPSAGRLPDALEPGIHGVGTQWIRGFMAFQLARYTRTVLLTVPE* |
Ga0134121_100685053 | 3300010401 | Terrestrial Soil | MDSGSHGVRTDWIRGFMPFHLVRHARTVMLMVPA* |
Ga0134121_102920802 | 3300010401 | Terrestrial Soil | LIMKIGPLPDVMDSGFHGVRTHWIRGFMAFRLARRTRTAMLMVPV* |
Ga0134121_132289661 | 3300010401 | Terrestrial Soil | AVDPGFHGVGTHWIWGFMAFQLACHARSMMLMVPM* |
Ga0134123_101324731 | 3300010403 | Terrestrial Soil | LPDALDPGFHGVRTPWIRGFMAFQLARRTRTVMLMAPVCP* |
Ga0134123_104141442 | 3300010403 | Terrestrial Soil | MKIGLLPDAMKPGIHRVGTHWIRGFMTFQPVRRIPTVRLMVPE* |
Ga0134123_129848781 | 3300010403 | Terrestrial Soil | MAIGLRSDALKPDIHCVRTHWIRGFMTFELARRTRIVLLMVPM* |
Ga0105246_100260513 | 3300011119 | Miscanthus Rhizosphere | MKPGIHCVRTPWIPGFMAFQMAARTRTVMLTVPV* |
Ga0137380_104616603 | 3300012206 | Vadose Zone Soil | MELGFHCVRTHWIRGFTAFQLARRTRTVLLAVLA* |
Ga0137376_106032202 | 3300012208 | Vadose Zone Soil | LPDVLEPDIHCVRTHWNRGFMTFQLARRTRIVMLMGPV* |
Ga0137379_100053388 | 3300012209 | Vadose Zone Soil | MKIGHPPDALEPGFHCVRTQWNRGFMAFQLVRRTRIMMLMVPA* |
Ga0137379_101356835 | 3300012209 | Vadose Zone Soil | MEPGFHCVRTHWIRGFMAFRLARRIGTVMLMVPA* |
Ga0137387_110855782 | 3300012349 | Vadose Zone Soil | MKIGPLPDALEPGVHCVKTCWIRGFMAFRLARRTRSVMLTVP |
Ga0137386_105840081 | 3300012351 | Vadose Zone Soil | GRLPDVMKPGIHCVRTHWIRGFMAFHRIRRTRAVMLMVPV* |
Ga0157340_10033501 | 3300012473 | Arabidopsis Rhizosphere | MEPGIHGARTHWIRGFMAFQLARYTRTVLLTVPE* |
Ga0157345_10108582 | 3300012498 | Arabidopsis Rhizosphere | MKPDFQCVRTHWNRGFMTFQLARQTRTVMLMVSK* |
Ga0164300_100636641 | 3300012951 | Soil | PAAGRLPDALEPGIHGVGTRWIRGFMAFQLARRTRTKMPMVRV* |
Ga0164298_100550063 | 3300012955 | Soil | AGRLPDALEPGIHGVGTRWIRGFMAFQLARYTRTVLLTVPE* |
Ga0164298_106644082 | 3300012955 | Soil | QPDVLEPEFHGARTHWIRGFTAFRLDRRARVVMLTVPV* |
Ga0164303_100584103 | 3300012957 | Soil | MDPGIYGVRTPWIRGFMTFQLGRRTRIVRLTVPA* |
Ga0164303_100907082 | 3300012957 | Soil | MKPEFHGVGTHWIRGFMAFRLARRTRTKMPMVPMVPV* |
Ga0164303_110967991 | 3300012957 | Soil | PDAVKPEFHGVGTHWIRGFMAFRLARRIRTVMLMVPT* |
Ga0164301_100214422 | 3300012960 | Soil | MKPEFHGVGTHWIRGFMAFHLARRTRTKMPMVPMVPV* |
Ga0164302_100037362 | 3300012961 | Soil | MDPGIHGVRTPWIRGFMTFQLGRRTRIVRLTVPA* |
Ga0164309_109155182 | 3300012984 | Soil | NAMKPYIHGVRAHWIRGFMAFQMARRTRTVVLMVPM* |
Ga0164309_110892642 | 3300012984 | Soil | VDAVKPGFHGVRAHWIRGFMAFQRARSTRTMLLMVPV* |
Ga0164308_104773773 | 3300012985 | Soil | MKPDIHGVRTRWIRGFMAFQLARRTRPAVLMVPAWLTRIL |
Ga0164308_106089141 | 3300012985 | Soil | MDPGIHGVRTPWIRGFMTFQLGRRTRIVGLTVPA* |
Ga0164308_120516562 | 3300012985 | Soil | ACRTHRPAAGRIGPLPDAMDPGIHGVRKPWIRGFMTFQLGRRTRIVRLTVPA* |
Ga0164304_113496042 | 3300012986 | Soil | GPLPDAMDPGIHGVRTPWIRGFMTFQLGRRTRIVGLTVPA* |
Ga0164304_114163321 | 3300012986 | Soil | DAMDPGIHGARTHWIRGFMAFQLARRTWAVMLMVPT* |
Ga0164307_115502541 | 3300012987 | Soil | LPDAVEPGFHGVRTRWIRGFMAFRLAQRIRTVRLTVPM* |
Ga0164306_100402691 | 3300012988 | Soil | LPDALDPRFHRVRTPWIRGFMAFRLARRIRIVMLMVLRVT* |
Ga0164306_112718552 | 3300012988 | Soil | PDALDPGFHCVRTPWIRGFMAFRSARRTRIVLLMVPM* |
Ga0164305_100667594 | 3300012989 | Soil | MKPYIHGVRAHWIRGFMAFQMTRRTRTVVLMVPM* |
Ga0157373_101794004 | 3300013100 | Corn Rhizosphere | IGLRPDALKPYIHCVRAPRGFMAFQMARRTRTVVLMVPM* |
Ga0157373_102041262 | 3300013100 | Corn Rhizosphere | MDSGFHGVRTPWIQGFMAFRLARRTRTAMLIVPV* |
Ga0157373_102488052 | 3300013100 | Corn Rhizosphere | MEPGIHGVRTQWFRGFMAFRLVRRIRTVMLMVLV* |
Ga0157371_105083132 | 3300013102 | Corn Rhizosphere | MKPGIHRVGTHWIRRFMAFKLARRIRDVRLMVPA* |
Ga0157370_114859261 | 3300013104 | Corn Rhizosphere | MELGFHCVQAHWIRGFMAFRLVRRTRTVMLMMSVGP |
Ga0157370_119685662 | 3300013104 | Corn Rhizosphere | RRPVPDALDPGFHCGRTPWIRGFMAFRLARRTRIVLLMVPM* |
Ga0157369_108881032 | 3300013105 | Corn Rhizosphere | MKPDIHCVRTHWIRGFIAFHSAQRTWAMMLMVPM* |
Ga0157369_114232702 | 3300013105 | Corn Rhizosphere | RPVPLPHALKPGFHCARTHWIRGFMAFELARPTRIVLLMVPV* |
Ga0157369_116260821 | 3300013105 | Corn Rhizosphere | MMIGPLPDAMKPGFHCVRTHWIRGFIAFRLVRRTSTVVLMVPA* |
Ga0157369_116966981 | 3300013105 | Corn Rhizosphere | MLLMTIDLLPDAMKPGFQCVRAHWIRGFMGFQLVRRRRSV |
Ga0157374_106012881 | 3300013296 | Miscanthus Rhizosphere | NLSRLPDAMEPRFHCVRTQWIRGFMAFQLARRAQYVMLMMPV* |
Ga0157374_110420742 | 3300013296 | Miscanthus Rhizosphere | MPDAMKSDIHGVRTHWIRGFMAFQLARCIRTVVLTVPV* |
Ga0157374_112106982 | 3300013296 | Miscanthus Rhizosphere | MPRGLLPDALKPGFQYARTQWIRGFMAFQLARRTRTVMLMVPM* |
Ga0157374_116589152 | 3300013296 | Miscanthus Rhizosphere | MAIGLRPDALKPDIHCVRTHWIRGFMAFQMARRTRTGLLMV |
Ga0157374_129483052 | 3300013296 | Miscanthus Rhizosphere | LIMAIGLRSDALKPDIHCVRTHWIRGVMTFELARGSRIVRLMGPI* |
Ga0157378_107260402 | 3300013297 | Miscanthus Rhizosphere | MYPGFHGVRTHWIRGFMAFRSDRRARMVMLTVPV* |
Ga0163162_105028972 | 3300013306 | Switchgrass Rhizosphere | MKPGFHGVGTHWIRGFMAFRLVRRTRTKMPMVPV* |
Ga0163162_124877201 | 3300013306 | Switchgrass Rhizosphere | MIMTIGPLPDAMKPGIHCVRTQWIWGFMAFQLVRCTRTVRLMVLM |
Ga0157372_113324081 | 3300013307 | Corn Rhizosphere | SAWCLTAMEPGIHCVRAHWIPGFMTFHPVRHARTVMLMVPT* |
Ga0157372_115370032 | 3300013307 | Corn Rhizosphere | MNSAYHCVRTHWIRGFMAFQLARHARTVMLMVLAWE* |
Ga0157372_115566862 | 3300013307 | Corn Rhizosphere | GALEPRIHGVRTHWIRGFMAFQLGRRTRNVVLMVSA* |
Ga0157372_116074592 | 3300013307 | Corn Rhizosphere | MKPGFHCVRTNWIRGFIVFGRVRHIGTVMLVVVP* |
Ga0157372_120004222 | 3300013307 | Corn Rhizosphere | DAVKPGIQCVRTPWIRGFMTFLRARHARIVMLMVPAWSGGV* |
Ga0157372_133829721 | 3300013307 | Corn Rhizosphere | LKPDIQCARTHWIRGFIAFQLARSTRTVLLMVPM* |
Ga0157375_104364832 | 3300013308 | Miscanthus Rhizosphere | MKPGFHVVGTHWIRGFMAFRLVRRTRTKTPMVPV* |
Ga0157375_123368822 | 3300013308 | Miscanthus Rhizosphere | MEPGIHGVTTHWIRGFMAFRLVRRTRIVMLMVPACPE |
Ga0157375_127193362 | 3300013308 | Miscanthus Rhizosphere | DAMKPGIHCARTHWIRGFMAFQLARRTRILMLMVPV* |
Ga0157375_137699152 | 3300013308 | Miscanthus Rhizosphere | MKIGPLPDVMDSGFHGVRTHWIRGFMAFRLARRTRTAMLIVPV* |
Ga0157380_116369681 | 3300014326 | Switchgrass Rhizosphere | MKPDIRGVRTRWIRGFMAFQLARYTRTALLTVPE* |
Ga0157377_100864513 | 3300014745 | Miscanthus Rhizosphere | MKPGIHGDRTYWIWGFMAFWLALRTRTAMLMVPE* |
Ga0157377_107029871 | 3300014745 | Miscanthus Rhizosphere | MKIGLLPDAMKPGIHGVGTHWIRGFMAFQPPRRTRAVMLMVPM |
Ga0157379_103704193 | 3300014968 | Switchgrass Rhizosphere | PHALKPGFHCARTHWIRGFMAFELALRTRIVMLMVPV* |
Ga0157379_107799902 | 3300014968 | Switchgrass Rhizosphere | SVCCWTLPDAVEPGFHGVGTRWIRGFMTFQLARRTQTVRLTVPV* |
Ga0157376_105673603 | 3300014969 | Miscanthus Rhizosphere | MEPGFHCVGTHWILGFMAFQLVRHVRTVMLMVPACPESGSLR |
Ga0137412_105197592 | 3300015242 | Vadose Zone Soil | MDPGFHCVRAHWIWGFMAFERARPTRIVRLMVLVGSESGFRD |
Ga0132256_1003726453 | 3300015372 | Arabidopsis Rhizosphere | MKPGIHCVSTRWIRGFMAFQLVRYARIVMLTVLA* |
Ga0163161_101236941 | 3300017792 | Switchgrass Rhizosphere | ALDPGFQCVRTHWIRGFMAFQLARRTRIVMLMVPV |
Ga0163161_110051442 | 3300017792 | Switchgrass Rhizosphere | MPDVMKPDIHCVRTRWIRGFMAFQMARRTPVVMLVVLM |
Ga0163161_112995371 | 3300017792 | Switchgrass Rhizosphere | MAIGLRSDALKPDIHCVRTHWIRGLMRFELARRTRIVLLMVPM |
Ga0163161_117167502 | 3300017792 | Switchgrass Rhizosphere | MPRGLLPDALKPGFQCARTQWIRGFMAFQLARRTRTVMLMVPM |
Ga0066669_110440042 | 3300018482 | Grasslands Soil | ALDSGFHRVRTHWIPGFMAFQLARSTRTVMLTVPV |
Ga0193722_10288782 | 3300019877 | Soil | DVMKPGFHCVRTHWIRGFMAFQMARRTPVLMLMVPV |
Ga0193722_11145462 | 3300019877 | Soil | DAMKPGFHCVRTHWIRGFIAFQLARCTRTVMLMMPA |
Ga0193730_11354691 | 3300020002 | Soil | GAMEPGVHCVRTHWIRGFMAFQLARRTRTAMLMVPV |
Ga0193730_11510482 | 3300020002 | Soil | LPDAMKPGFHCVRTHWIRGFMAFQLARRTRTVMLMVPE |
Ga0197907_114006202 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | PLPDAMEPGFHGVRTPWIRRFMPFQLAPRARIVMLMV |
Ga0206356_108080021 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | PDAMKPGIHGDRTHWIRGFMTFQQPGAPGTVMLMVPE |
Ga0206353_116410851 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | PGAMPDAVDQGFHCARTQWIRGFMLFRLVRRIRTMMLMVPV |
Ga0210393_108687221 | 3300021401 | Soil | MKPGIHGVRAHWIRGFMAFRRGRRIRIVMLMGSMGPES |
Ga0210397_101556882 | 3300021403 | Soil | MKIGPLPDAMKPRFHGVGTHWIQGFMAFQSTRRTRITMLMVPV |
Ga0210389_103048683 | 3300021404 | Soil | MKIGPLPDAMKPRFHGVGTHWIQGFMAFQSTRRTRIAMLMVPV |
Ga0210392_102349281 | 3300021475 | Soil | VVDGLDPGIHGARTRWIRGFMAFQLAWRIRIVMLMVPV |
Ga0210392_106318941 | 3300021475 | Soil | PRTRPSPLPGDLKPDIHCVRTHWIRGFMPFQLTRRTRTVVPM |
Ga0222622_101367031 | 3300022756 | Groundwater Sediment | GLRDPMKPDVHCVRTHWIRGFIAFHSAQRTWAVMLMVPM |
Ga0247665_10731301 | 3300024219 | Soil | AAGRLPDAMDPGFHGARTHWIRGFMTFRLVRRTRAVR |
Ga0247664_10998982 | 3300024232 | Soil | PTPAGRIGPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA |
Ga0247661_10264363 | 3300024254 | Soil | GRLLDAMDPGFHGARTHWIRGFMTFRLVRRTRAVR |
Ga0247661_10791941 | 3300024254 | Soil | DCEARPRPYAMEPDIHGVRTHWIRGFMAFWLARRTRIVRLMVPA |
Ga0247668_10709021 | 3300024331 | Soil | CRIPGPDALKPYIHCVRAPRGFMAFQMARRTRTVVLMVPM |
Ga0247668_10906001 | 3300024331 | Soil | GPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA |
Ga0207653_100189021 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | ALEPGFHCVGTHWIRGFMAFRLVRRTRAVMLVVPT |
Ga0207653_100393121 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTRAVMLMVSMCPES |
Ga0207653_101239893 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VPLPHALKPGFHCARTHWIRGFMAFELARPTRIVLLMVPM |
Ga0207710_101669682 | 3300025900 | Switchgrass Rhizosphere | LIVTIGPLPDAMEPGFHGVRTPWIRRFMPFQLAPRARIVMLMV |
Ga0207710_102480341 | 3300025900 | Switchgrass Rhizosphere | QPNAMDSGSHGVRTDWIRGFMPFHLVRHARTVMLMVPA |
Ga0207710_104818172 | 3300025900 | Switchgrass Rhizosphere | MKIGLLPDAMKPGIHGVGTHWIRGFMAFQPPRRARAVMLMVPM |
Ga0207680_102138691 | 3300025903 | Switchgrass Rhizosphere | TGLPPNALDSGFHGVRTPWIRGFMAFQRARRTRTMRLTVPV |
Ga0207685_100144054 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | PDAMEPDIHGVRAHWIRGFMAFWLARRTRIVRLVVSA |
Ga0207685_101256872 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTVLLMVPM |
Ga0207685_101268641 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GADRAAMKPGIHGDRTHWIRGFMAFWLARRTRTAMLMGSA |
Ga0207699_103426592 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VPNALDSGIHGARTHWIRGFMPFRLARRTQIVRLMVLA |
Ga0207643_102310861 | 3300025908 | Miscanthus Rhizosphere | PLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA |
Ga0207705_102420461 | 3300025909 | Corn Rhizosphere | VLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMV |
Ga0207654_101683711 | 3300025911 | Corn Rhizosphere | MAIGLRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVPM |
Ga0207671_110158482 | 3300025914 | Corn Rhizosphere | HALKPGFHGARTHWIRGFMAFELARRTWIVMLMVPV |
Ga0207663_112686862 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VNAALGPLPNALDPGFQCVRTHWIRGFMAFRLARRTRTVMLTVPE |
Ga0207663_114724041 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GGHEVPQWGFHGVRTPWIRGFMAFRLARRTRTAMLMVPA |
Ga0207660_101579151 | 3300025917 | Corn Rhizosphere | DAMDPGFHGVRTHWIRGFMAFRSDRRARMVMLTVPV |
Ga0207660_104981942 | 3300025917 | Corn Rhizosphere | YPGPGADRDAMKPGIHGDRTHWIRGFMAFWLARRTRTAMLMVPE |
Ga0207662_100214505 | 3300025918 | Switchgrass Rhizosphere | MKIGPLPDVMDSGFHGVRTPWIRGFMAFRLARRTRTAMLMGG |
Ga0207652_102002961 | 3300025921 | Corn Rhizosphere | SIAAGVGPDAVDPGFHGVGTHWIRGFMAFRLACHARSVMLMVPM |
Ga0207652_106507431 | 3300025921 | Corn Rhizosphere | TPPGRPPDAMKPGFHGVGTHWIRGFMAFRLARRTRTKMPMVPV |
Ga0207694_112386281 | 3300025924 | Corn Rhizosphere | PDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA |
Ga0207659_116296361 | 3300025926 | Miscanthus Rhizosphere | LPDAPPDALDSGFHRVRTHWIRGFMAFRLVQRIRIVMLMVPV |
Ga0207687_109618821 | 3300025927 | Miscanthus Rhizosphere | LIMAIGLRSDALKPDIHCVRTHWIRGVMTFELARLTRIVLLMVPM |
Ga0207700_119037171 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAEAGPDAVDPGFHGVGTHWIWGFMAFQLACHARSMMLMVPM |
Ga0207664_111758532 | 3300025929 | Agricultural Soil | RRFLRPDAVKPAFHGVRTRWIRGFMAFQRARSTRIMLLMVPV |
Ga0207664_113493142 | 3300025929 | Agricultural Soil | PVPDALDPGFHCVRTPWIRGFMAFRLARRTRIVLLMVPM |
Ga0207709_107959171 | 3300025935 | Miscanthus Rhizosphere | LLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT |
Ga0207670_106409961 | 3300025936 | Switchgrass Rhizosphere | MKIGLLPDAMKPGIHGVGTHWIRGFMAFQPPRRTRAVMLMV |
Ga0207704_104145562 | 3300025938 | Miscanthus Rhizosphere | MKPGIHCVRTHWIRGFMAFQLAERARAVMLMVPVCPEC |
Ga0207704_107754891 | 3300025938 | Miscanthus Rhizosphere | SRSRPGRLDIAMEPGIHGVRTQWIRGFMAFRLVRRIRTVMLMVLV |
Ga0207691_100568494 | 3300025940 | Miscanthus Rhizosphere | VSADVLDPGFHGARTRWNRGFMTFQLVRRTQIAMLMVPV |
Ga0207691_104962142 | 3300025940 | Miscanthus Rhizosphere | VLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAV |
Ga0207711_107772531 | 3300025941 | Switchgrass Rhizosphere | MKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTLVVMLMVPMCPESG |
Ga0207689_100207326 | 3300025942 | Miscanthus Rhizosphere | LIMAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTGLLMVPV |
Ga0207689_117491002 | 3300025942 | Miscanthus Rhizosphere | SDGLKPGIHCARTHWIRGFIAFRLARRTRIVMLMVPA |
Ga0207661_105345851 | 3300025944 | Corn Rhizosphere | VPQWGFHGARAPWIRGFMAFQLARRARIVRLMVPA |
Ga0207679_115068101 | 3300025945 | Corn Rhizosphere | APPVLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT |
Ga0207667_110824392 | 3300025949 | Corn Rhizosphere | MAIGLRSDALKRDIHCVRTHWIRGFMTFELARRTRIVLLMVPM |
Ga0207651_113994542 | 3300025960 | Switchgrass Rhizosphere | RIGPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA |
Ga0207651_117917431 | 3300025960 | Switchgrass Rhizosphere | APACLPDALDPGFHGVRTPWIRGFMAFQPARRTRIVRLMVPV |
Ga0207712_103266142 | 3300025961 | Switchgrass Rhizosphere | MPAGRLPDALKPDIQCARTHWIRGFIAFQLARRTRTVLLMVPM |
Ga0207668_100993902 | 3300025972 | Switchgrass Rhizosphere | VNAALGPLPNALEPGFQCVRTHWIRGFMAFRLARRTRTVMLTVPE |
Ga0207677_117748551 | 3300026023 | Miscanthus Rhizosphere | VPTPAERRPDAVKPGFHCARTHWIPGFMAFRLARRTRLVMLMVPV |
Ga0207703_102707011 | 3300026035 | Switchgrass Rhizosphere | MPRGLLSYALKPGFQCARTQWIRGFMAFQLARRTRTVMLMVPM |
Ga0207639_101166333 | 3300026041 | Corn Rhizosphere | GAMPDAVDQGFHCARTQWIRGFMLFRLVRRIRTMMLMVPV |
Ga0207639_101292991 | 3300026041 | Corn Rhizosphere | MAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTGLLMVPV |
Ga0207639_117378161 | 3300026041 | Corn Rhizosphere | AGRIGPLPDAMDPGIHGVRTPWIRGSMTFQLARRTRIVRLTVPA |
Ga0207708_109190673 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | GLPDAMKLGFHCVRAHWIRGFMAFHLVRRTRIVMLMMPVCP |
Ga0207702_110729483 | 3300026078 | Corn Rhizosphere | LRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVPM |
Ga0207674_100277185 | 3300026116 | Corn Rhizosphere | MATGLRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVPM |
Ga0207674_100653834 | 3300026116 | Corn Rhizosphere | VLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLM |
Ga0207675_1000210168 | 3300026118 | Switchgrass Rhizosphere | DALDPGFHCVRTRWIRGFMAFQLARRTRTAMLMVPV |
Ga0207675_1022061882 | 3300026118 | Switchgrass Rhizosphere | PDAMNSAYHCVRTHWIRGFMAFQLARHARTVMLMVLAWE |
Ga0207683_100150161 | 3300026121 | Miscanthus Rhizosphere | MPDAMKPDIHGVRTHWIRGFMAFQPARRTRTLVLTVPVWPESGF |
Ga0207683_102378001 | 3300026121 | Miscanthus Rhizosphere | SGALEPRIHGVRTHWIRGFMAFQLGRRTRNVVLMVPA |
Ga0209110_10126732 | 3300027002 | Forest Soil | ASDPGIHGVRTPWIRGFRTFQLGRRTRIVRLTVPA |
Ga0209325_10059792 | 3300027050 | Forest Soil | ARAPPDVLKPDIQCVRTHWIRGFMAFQLARRTRIVVLMGSV |
Ga0208862_1035782 | 3300027100 | Forest Soil | VLLPNAMKPGIHGARTHWIRGFMAFQLARYARTVLLTVP |
Ga0209178_13880852 | 3300027725 | Agricultural Soil | PLPDALDPGFHCVRTPWIRGFMAFQLARRTRIVLLMVPM |
Ga0209073_103375881 | 3300027765 | Agricultural Soil | MAIGLWPDALKLDIHCVRAHWIRGFSAFQLARRTRIVLLMVPV |
Ga0209177_101275182 | 3300027775 | Agricultural Soil | RPDAVDPGFHGVRAHWIQGFTAFQLTRHGPRVMLMTPV |
Ga0247675_10133381 | 3300028072 | Soil | GRIGPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA |
Ga0247675_10188111 | 3300028072 | Soil | MKIGLLPDAMKPGIHGVGTHWIRGFMAFQPPRRARAV |
Ga0247682_10543652 | 3300028146 | Soil | VLKPYCIGLLPDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT |
Ga0247682_10577191 | 3300028146 | Soil | MKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTRAVMLMV |
Ga0268266_112018972 | 3300028379 | Switchgrass Rhizosphere | MNSAYHCVRTHWIRGFMAFQLARHARTVMLMVLAWE |
Ga0268266_114028941 | 3300028379 | Switchgrass Rhizosphere | EVPQWGFHGVRTPWIRGFMAFRLARRTRTAMLMVPA |
Ga0268266_119360792 | 3300028379 | Switchgrass Rhizosphere | ALKPDIQCVRTHWIRGFMAFQLARHTRIVVLMGSA |
Ga0268264_124025692 | 3300028381 | Switchgrass Rhizosphere | HEARPRPDAMEPDIHGVRTHWIRGFMAFWLARRTRIVRLVVSA |
Ga0307279_100873521 | 3300028709 | Soil | MRLGPLPDDLKPDIHCVTTHWNRGFMGFQLAQLTRTVMPMVPM |
Ga0307317_102200132 | 3300028720 | Soil | DAMKPGFHCVRTHWIRGFIAFRLVRRTSTVVLMVPA |
Ga0307280_100851272 | 3300028768 | Soil | MPLIMTIGPLPNALDPGFHCVRTHWIRGFMAFQLARHTRIVMLAVPV |
Ga0307280_103009561 | 3300028768 | Soil | MKPGIHCTRTHWIRGFMTFQLVRHAPTVMLTVPACPE |
Ga0307282_101236752 | 3300028784 | Soil | MGPGFHCVGTYWIRGFMAFQLARRARFVMLMMPVGPESDLR |
Ga0307282_101478952 | 3300028784 | Soil | GYPRPGFHCVRTHWIRGFMAFQMARRTPVLMLMVPV |
Ga0307282_104862262 | 3300028784 | Soil | SGYPGPGFHCVTTHWIRGFMAFQLARRTRTVMLMVSV |
Ga0307323_100574593 | 3300028787 | Soil | CVGTYWIRGFMAFQLARRARLVMLMMPVGPESDLR |
Ga0307290_101671441 | 3300028791 | Soil | MEPGFHFDRAHWIRGFMTFQRVRRTSTVMLMVPVGPVSNPLD |
Ga0307290_103834091 | 3300028791 | Soil | VVDARPDALDPGFHCARTHWIRGFMTFQLVRRIRTVMLM |
Ga0307299_102049921 | 3300028793 | Soil | VPLPHALKPGFHCARTHWIRGFMAFELARRTWIVMLMVPV |
Ga0307299_103749852 | 3300028793 | Soil | RRSRLRQNALDPGFHCVRTHWIRGFMALQLARRTRTVLLMVPV |
Ga0307284_104291531 | 3300028799 | Soil | TIGPPPNALDPGFHCVRTHWIRGFMAFQLARHTRIVMLAVPV |
Ga0307305_101369611 | 3300028807 | Soil | ATPVPGGLRDPMKPDIHRVRTHWIRGFRAFHSAQRTWEVMLMVPM |
Ga0307296_108426831 | 3300028819 | Soil | DADALEPGFHCVRTHWIRGSMAFQLVRRTRTVMLMVSV |
Ga0307312_100323695 | 3300028828 | Soil | VPQWGFHCVRTHWIRGSMAFRLARCTRIVLLVVPV |
Ga0307312_106002241 | 3300028828 | Soil | PRSRIPDAMESGFHCVRMHWIRGFMAFRLARRTQT |
Ga0307312_111213842 | 3300028828 | Soil | PGGVFSVWSLPDALKPGFQCVRTQWIRGFIAFQLARRIRTVVLMVPV |
Ga0307308_100286701 | 3300028884 | Soil | MPLIMTIGPLPNALDPGFRCVTTHWIRGFMAFQLARHTRIVMLAVPV |
Ga0308194_103298742 | 3300031421 | Soil | GIHCVRTHWIRGFMAFQLVRRIRIVMLMVPVCPEFGFL |
Ga0307469_114536281 | 3300031720 | Hardwood Forest Soil | PGALDSGFHCARTHWIRGFMAFQLVRRTRIVRLMVSV |
Ga0307469_116216142 | 3300031720 | Hardwood Forest Soil | LIMAIGLWPDALKPDIHCVRAHWIRGFMAFQTARRTRIVLLMVPV |
Ga0307469_124372511 | 3300031720 | Hardwood Forest Soil | MAIGLRSDALKPEIHCVRTHWIRGFMTFELARRTRIVLLMVPM |
Ga0307468_1005196033 | 3300031740 | Hardwood Forest Soil | LLPDALKPDIHCVRAHWIRGFMAFQTARRTRIVLLMVPV |
Ga0307473_115362131 | 3300031820 | Hardwood Forest Soil | GPAGSGPPDALEPGFHCVRAHWIRGFMAFELARRTRTVRLMMSA |
Ga0308176_112236711 | 3300031996 | Soil | ACRTPAGRLPDALEPGIQCVRTHWIRGFMAFRLARHTRNVMLMVPT |
Ga0308173_106170191 | 3300032074 | Soil | MLIMKLGPAAGRLPDALKPGFHCARTHWIRGFIVFRPARLTRIVRLMV |
Ga0307470_109528592 | 3300032174 | Hardwood Forest Soil | LPNAMKPGFHRVRTHWIRGFMAFQRARCTRIVLLAVPV |
Ga0307470_115182421 | 3300032174 | Hardwood Forest Soil | PEPPPDALKPDFQCVRTHWIRGFMAFQLVWRTRIVMLMVLK |
Ga0307471_1002652782 | 3300032180 | Hardwood Forest Soil | PDAMEPDIHGVRTHWIRGFMAFWLARRTRIVRLVVSA |
Ga0307471_1006663511 | 3300032180 | Hardwood Forest Soil | LPDAMEPGFHCVRAHWIWGFIAFQLARRTRTVMLMVLA |
Ga0307471_1018209391 | 3300032180 | Hardwood Forest Soil | PAPGPGLHGALDPGFHCARTHWARGFMTFQLARRTRIVMLMVSV |
Ga0307472_1001792424 | 3300032205 | Hardwood Forest Soil | LIMAIGLRSDALKPDIHCVRTHWIRGLMRFELARRTRIVLLMVPM |
Ga0307472_1004629691 | 3300032205 | Hardwood Forest Soil | MKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTRAVMLMVS |
Ga0307472_1024266071 | 3300032205 | Hardwood Forest Soil | VPLPHALKPGFHCARTHWIRGFMAFELARPTRIVLLMVPV |
Ga0335079_100234688 | 3300032783 | Soil | MVAGPVPDSVEPGFHCVRTRWIRGFIASRLARRTHGLMLMVPA |
Ga0335075_108215582 | 3300032896 | Soil | VDPADAVDPDIHGVGTHWIRAFMAFWLARRTRIVRLMVSA |
Ga0335072_105174901 | 3300032898 | Soil | PKPGPNALNPRIHCARAHWIRGFMTFRLARRTRTAVLMVPT |
Ga0335084_112932632 | 3300033004 | Soil | PDAMEPGFHCVGTHRIRGFMAFQSDRRTRTVMLMMPT |
Ga0310810_113286021 | 3300033412 | Soil | NALEPGVHCVRTHWIRGFMAFRRVRRTSTAMLMVPV |
Ga0373948_0106278_541_666 | 3300034817 | Rhizosphere Soil | IGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT |
Ga0373950_0094102_3_116 | 3300034818 | Rhizosphere Soil | PDALKPRIHGLRTPWIRGFMTFQLVRRTQIAMLMVPV |
Ga0373950_0111174_2_136 | 3300034818 | Rhizosphere Soil | RPAAGRLPDALEPGIHGVGTHWIRGFMAFQLARYTRTVLLTVPE |
Ga0373958_0132229_1_129 | 3300034819 | Rhizosphere Soil | MPAGRLLDAMEPGFHCARTPWIRGFMALQLTRRGRTVRLIVPV |
Ga0373959_0070960_3_125 | 3300034820 | Rhizosphere Soil | GRLPDAVEPGFHGVGTRWIRGFMTFQLTRRTQTVGLTVPV |
Ga0373959_0141411_2_112 | 3300034820 | Rhizosphere Soil | MRHYALDSGFQCVRTHWIRGSTACQLARRLPAGMLMV |
⦗Top⦘ |