Basic Information | |
---|---|
Family ID | F004384 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 440 |
Average Sequence Length | 47 residues |
Representative Sequence | MHLHLVRVAARPKQAPRPAKVVVLETRRKARLEAARPERQPPRPAA |
Number of Associated Samples | 307 |
Number of Associated Scaffolds | 440 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.91 % |
% of genes near scaffold ends (potentially truncated) | 31.82 % |
% of genes from short scaffolds (< 2000 bps) | 83.41 % |
Associated GOLD sequencing projects | 285 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.636 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.546 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.091 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.27% β-sheet: 0.00% Coil/Unstructured: 79.73% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 440 Family Scaffolds |
---|---|---|
PF05731 | TROVE | 9.09 |
PF01139 | RtcB | 5.91 |
PF10127 | RlaP | 5.68 |
PF02810 | SEC-C | 1.14 |
PF00717 | Peptidase_S24 | 1.14 |
PF01872 | RibD_C | 0.91 |
PF00144 | Beta-lactamase | 0.68 |
PF02518 | HATPase_c | 0.68 |
PF08031 | BBE | 0.45 |
PF01594 | AI-2E_transport | 0.45 |
PF00248 | Aldo_ket_red | 0.45 |
PF03176 | MMPL | 0.45 |
PF00486 | Trans_reg_C | 0.45 |
PF01243 | Putative_PNPOx | 0.45 |
PF12688 | TPR_5 | 0.45 |
PF03640 | Lipoprotein_15 | 0.23 |
PF02219 | MTHFR | 0.23 |
PF00378 | ECH_1 | 0.23 |
PF03992 | ABM | 0.23 |
PF05227 | CHASE3 | 0.23 |
PF04951 | Peptidase_M55 | 0.23 |
PF00004 | AAA | 0.23 |
PF01261 | AP_endonuc_2 | 0.23 |
PF03706 | LPG_synthase_TM | 0.23 |
PF01726 | LexA_DNA_bind | 0.23 |
PF03704 | BTAD | 0.23 |
PF01625 | PMSR | 0.23 |
PF03602 | Cons_hypoth95 | 0.23 |
PF13442 | Cytochrome_CBB3 | 0.23 |
PF00171 | Aldedh | 0.23 |
PF03928 | HbpS-like | 0.23 |
PF02653 | BPD_transp_2 | 0.23 |
PF13185 | GAF_2 | 0.23 |
PF02515 | CoA_transf_3 | 0.23 |
PF10589 | NADH_4Fe-4S | 0.23 |
PF13481 | AAA_25 | 0.23 |
PF01925 | TauE | 0.23 |
PF00662 | Proton_antipo_N | 0.23 |
PF02567 | PhzC-PhzF | 0.23 |
PF14572 | Pribosyl_synth | 0.23 |
PF02608 | Bmp | 0.23 |
PF07728 | AAA_5 | 0.23 |
PF13379 | NMT1_2 | 0.23 |
PF00534 | Glycos_transf_1 | 0.23 |
PF05088 | Bac_GDH | 0.23 |
PF12399 | BCA_ABC_TP_C | 0.23 |
PF04075 | F420H2_quin_red | 0.23 |
PF07099 | DUF1361 | 0.23 |
PF04879 | Molybdop_Fe4S4 | 0.23 |
PF07992 | Pyr_redox_2 | 0.23 |
PF12833 | HTH_18 | 0.23 |
PF12623 | Hen1_L | 0.23 |
PF08669 | GCV_T_C | 0.23 |
COG ID | Name | Functional Category | % Frequency in 440 Family Scaffolds |
---|---|---|---|
COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 5.91 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.91 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.91 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.68 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.68 |
COG1009 | Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit | Energy production and conversion [C] | 0.45 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.45 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.45 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.45 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.45 |
COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.23 |
COG4330 | Uncharacterized membrane protein, DUF1361 domain | Function unknown [S] | 0.23 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.23 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.23 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.23 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.23 |
COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.23 |
COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.23 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.23 |
COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 0.23 |
COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.23 |
COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.23 |
COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.23 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.23 |
COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.23 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.23 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.55 % |
Unclassified | root | N/A | 25.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459007|GJ61VE201C85AJ | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300000891|JGI10214J12806_11186455 | Not Available | 526 | Open in IMG/M |
3300000955|JGI1027J12803_102160437 | Not Available | 557 | Open in IMG/M |
3300000956|JGI10216J12902_103780722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
3300002568|C688J35102_120681636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1344 | Open in IMG/M |
3300003267|soilL1_10111841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684 | 1742 | Open in IMG/M |
3300004016|Ga0058689_10132752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300004081|Ga0063454_101516095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 574 | Open in IMG/M |
3300004156|Ga0062589_100560483 | Not Available | 980 | Open in IMG/M |
3300004157|Ga0062590_102905601 | Not Available | 513 | Open in IMG/M |
3300004463|Ga0063356_100724134 | Not Available | 1373 | Open in IMG/M |
3300004479|Ga0062595_100186088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1264 | Open in IMG/M |
3300004480|Ga0062592_101301092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
3300004480|Ga0062592_101321431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
3300004643|Ga0062591_101527486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. ap11 | 669 | Open in IMG/M |
3300004798|Ga0058859_11668266 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300005093|Ga0062594_101709797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
3300005172|Ga0066683_10823585 | Not Available | 538 | Open in IMG/M |
3300005177|Ga0066690_11035905 | Not Available | 514 | Open in IMG/M |
3300005179|Ga0066684_10144037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1506 | Open in IMG/M |
3300005179|Ga0066684_10635104 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300005181|Ga0066678_10228481 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300005184|Ga0066671_10386596 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300005328|Ga0070676_10165161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1428 | Open in IMG/M |
3300005329|Ga0070683_100100840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. GbtcB7 | 2718 | Open in IMG/M |
3300005329|Ga0070683_100126547 | All Organisms → cellular organisms → Bacteria | 2416 | Open in IMG/M |
3300005329|Ga0070683_100142342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2272 | Open in IMG/M |
3300005329|Ga0070683_100312607 | Not Available | 1495 | Open in IMG/M |
3300005329|Ga0070683_100655796 | Not Available | 1005 | Open in IMG/M |
3300005329|Ga0070683_100678402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 987 | Open in IMG/M |
3300005330|Ga0070690_100346685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
3300005332|Ga0066388_100652847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1666 | Open in IMG/M |
3300005332|Ga0066388_100884619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1474 | Open in IMG/M |
3300005334|Ga0068869_100460413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1056 | Open in IMG/M |
3300005335|Ga0070666_10163832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1555 | Open in IMG/M |
3300005338|Ga0068868_100225720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1569 | Open in IMG/M |
3300005338|Ga0068868_100331272 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24 | 1299 | Open in IMG/M |
3300005341|Ga0070691_10504528 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300005341|Ga0070691_10698272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. ap11 | 609 | Open in IMG/M |
3300005343|Ga0070687_101504414 | Not Available | 506 | Open in IMG/M |
3300005344|Ga0070661_101499638 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300005345|Ga0070692_10387445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 879 | Open in IMG/M |
3300005434|Ga0070709_10104556 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
3300005435|Ga0070714_100566369 | Not Available | 1089 | Open in IMG/M |
3300005435|Ga0070714_100892052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 863 | Open in IMG/M |
3300005436|Ga0070713_100598875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1047 | Open in IMG/M |
3300005438|Ga0070701_10185498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1221 | Open in IMG/M |
3300005440|Ga0070705_100263403 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300005441|Ga0070700_101440842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
3300005445|Ga0070708_100023960 | All Organisms → cellular organisms → Bacteria | 5196 | Open in IMG/M |
3300005445|Ga0070708_100035944 | All Organisms → cellular organisms → Bacteria | 4318 | Open in IMG/M |
3300005450|Ga0066682_10513851 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300005467|Ga0070706_100626631 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300005467|Ga0070706_101642816 | Not Available | 586 | Open in IMG/M |
3300005471|Ga0070698_100455708 | Not Available | 1215 | Open in IMG/M |
3300005471|Ga0070698_101267894 | Not Available | 687 | Open in IMG/M |
3300005518|Ga0070699_100674865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. OxB-1 | 944 | Open in IMG/M |
3300005518|Ga0070699_100709892 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300005518|Ga0070699_101693395 | Not Available | 579 | Open in IMG/M |
3300005526|Ga0073909_10548741 | Not Available | 565 | Open in IMG/M |
3300005529|Ga0070741_10000289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 192776 | Open in IMG/M |
3300005529|Ga0070741_10039150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6190 | Open in IMG/M |
3300005529|Ga0070741_10633638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 950 | Open in IMG/M |
3300005530|Ga0070679_100079565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3267 | Open in IMG/M |
3300005530|Ga0070679_100494734 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa | 1167 | Open in IMG/M |
3300005546|Ga0070696_100863383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300005547|Ga0070693_100288403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1102 | Open in IMG/M |
3300005549|Ga0070704_100439689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1121 | Open in IMG/M |
3300005552|Ga0066701_10756995 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005553|Ga0066695_10250077 | Not Available | 1119 | Open in IMG/M |
3300005557|Ga0066704_10583134 | Not Available | 722 | Open in IMG/M |
3300005558|Ga0066698_10559326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 776 | Open in IMG/M |
3300005560|Ga0066670_10046544 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
3300005562|Ga0058697_10000126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 38399 | Open in IMG/M |
3300005569|Ga0066705_10904763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. ap11 | 524 | Open in IMG/M |
3300005614|Ga0068856_100643569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1081 | Open in IMG/M |
3300005614|Ga0068856_101121299 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300005614|Ga0068856_102424995 | Not Available | 532 | Open in IMG/M |
3300005615|Ga0070702_101830766 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005713|Ga0066905_100184211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1544 | Open in IMG/M |
3300005713|Ga0066905_100912015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 770 | Open in IMG/M |
3300005718|Ga0068866_10189245 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24 | 1222 | Open in IMG/M |
3300005719|Ga0068861_101972520 | Not Available | 582 | Open in IMG/M |
3300005764|Ga0066903_100974887 | Not Available | 1546 | Open in IMG/M |
3300005764|Ga0066903_101894824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1142 | Open in IMG/M |
3300005764|Ga0066903_101910399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Candidatus Polarisedimenticolia → Candidatus Polarisedimenticolales → Candidatus Polarisedimenticolaceae → Candidatus Polarisedimenticola → Candidatus Polarisedimenticola svalbardensis | 1137 | Open in IMG/M |
3300005764|Ga0066903_102901203 | Not Available | 930 | Open in IMG/M |
3300005764|Ga0066903_103958114 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300005764|Ga0066903_105944608 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300005764|Ga0066903_108698748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
3300005841|Ga0068863_100068963 | Not Available | 3344 | Open in IMG/M |
3300006028|Ga0070717_10202839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1738 | Open in IMG/M |
3300006031|Ga0066651_10378758 | Not Available | 756 | Open in IMG/M |
3300006046|Ga0066652_100142103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2001 | Open in IMG/M |
3300006046|Ga0066652_100376033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1287 | Open in IMG/M |
3300006046|Ga0066652_100756299 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300006046|Ga0066652_101238282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
3300006058|Ga0075432_10072176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1242 | Open in IMG/M |
3300006196|Ga0075422_10260945 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300006580|Ga0074049_12756487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. ap11 | 506 | Open in IMG/M |
3300006755|Ga0079222_10284791 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300006797|Ga0066659_10995380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300006797|Ga0066659_11062597 | Not Available | 676 | Open in IMG/M |
3300006806|Ga0079220_10463040 | Not Available | 852 | Open in IMG/M |
3300006806|Ga0079220_11453590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 585 | Open in IMG/M |
3300006844|Ga0075428_101294619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. ap11 | 767 | Open in IMG/M |
3300006852|Ga0075433_10163650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1980 | Open in IMG/M |
3300006852|Ga0075433_10656027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 920 | Open in IMG/M |
3300006852|Ga0075433_11268259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
3300006853|Ga0075420_101683060 | Not Available | 543 | Open in IMG/M |
3300006854|Ga0075425_102008052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300006876|Ga0079217_10008838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3164 | Open in IMG/M |
3300006880|Ga0075429_100943132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
3300006881|Ga0068865_100391177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1136 | Open in IMG/M |
3300006894|Ga0079215_10094378 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300006904|Ga0075424_100361154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1547 | Open in IMG/M |
3300006904|Ga0075424_100749065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1043 | Open in IMG/M |
3300006904|Ga0075424_102633436 | Not Available | 526 | Open in IMG/M |
3300006953|Ga0074063_13962468 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300006954|Ga0079219_11412346 | Not Available | 623 | Open in IMG/M |
3300006969|Ga0075419_10199330 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300007004|Ga0079218_12153148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
3300009012|Ga0066710_100903292 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300009012|Ga0066710_103312600 | Not Available | 615 | Open in IMG/M |
3300009093|Ga0105240_10676432 | Not Available | 1129 | Open in IMG/M |
3300009094|Ga0111539_10271236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1975 | Open in IMG/M |
3300009094|Ga0111539_11497860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
3300009094|Ga0111539_11970213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
3300009098|Ga0105245_10167177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2092 | Open in IMG/M |
3300009098|Ga0105245_12234546 | Not Available | 601 | Open in IMG/M |
3300009100|Ga0075418_10054066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4300 | Open in IMG/M |
3300009101|Ga0105247_10543506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 853 | Open in IMG/M |
3300009137|Ga0066709_103460321 | Not Available | 573 | Open in IMG/M |
3300009137|Ga0066709_104492805 | Not Available | 510 | Open in IMG/M |
3300009147|Ga0114129_10312941 | Not Available | 2089 | Open in IMG/M |
3300009147|Ga0114129_10742234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1257 | Open in IMG/M |
3300009147|Ga0114129_12115982 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300009148|Ga0105243_12534265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 552 | Open in IMG/M |
3300009156|Ga0111538_12382890 | Not Available | 664 | Open in IMG/M |
3300009156|Ga0111538_12728348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
3300009177|Ga0105248_10437156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1474 | Open in IMG/M |
3300009177|Ga0105248_12886953 | Not Available | 548 | Open in IMG/M |
3300009545|Ga0105237_12075988 | Not Available | 577 | Open in IMG/M |
3300009789|Ga0126307_10010818 | All Organisms → cellular organisms → Bacteria | 6631 | Open in IMG/M |
3300009789|Ga0126307_10080982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2564 | Open in IMG/M |
3300009789|Ga0126307_10907868 | Not Available | 711 | Open in IMG/M |
3300009789|Ga0126307_11021234 | Not Available | 668 | Open in IMG/M |
3300009792|Ga0126374_11006507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 654 | Open in IMG/M |
3300009799|Ga0105075_1045148 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300009840|Ga0126313_10100606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 2125 | Open in IMG/M |
3300009873|Ga0131077_10014496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 24642 | Open in IMG/M |
3300009873|Ga0131077_10867979 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300010037|Ga0126304_10046860 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300010037|Ga0126304_10333823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
3300010037|Ga0126304_10525122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 796 | Open in IMG/M |
3300010038|Ga0126315_10123743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1509 | Open in IMG/M |
3300010038|Ga0126315_10536384 | Not Available | 750 | Open in IMG/M |
3300010040|Ga0126308_10817593 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300010041|Ga0126312_10886454 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa | 650 | Open in IMG/M |
3300010042|Ga0126314_11130270 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300010044|Ga0126310_10746040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
3300010045|Ga0126311_11258716 | Not Available | 614 | Open in IMG/M |
3300010045|Ga0126311_11421673 | Not Available | 579 | Open in IMG/M |
3300010124|Ga0127498_1042726 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300010152|Ga0126318_11088818 | Not Available | 650 | Open in IMG/M |
3300010166|Ga0126306_10838741 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300010303|Ga0134082_10187560 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300010321|Ga0134067_10400671 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300010326|Ga0134065_10221370 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300010326|Ga0134065_10236206 | Not Available | 676 | Open in IMG/M |
3300010329|Ga0134111_10531531 | Not Available | 519 | Open in IMG/M |
3300010335|Ga0134063_10468421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 626 | Open in IMG/M |
3300010336|Ga0134071_10248059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 886 | Open in IMG/M |
3300010337|Ga0134062_10376823 | Not Available | 689 | Open in IMG/M |
3300010359|Ga0126376_12911687 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300010362|Ga0126377_10291813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1605 | Open in IMG/M |
3300010362|Ga0126377_13395599 | Not Available | 515 | Open in IMG/M |
3300010371|Ga0134125_13067075 | Not Available | 506 | Open in IMG/M |
3300010375|Ga0105239_10003000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 21043 | Open in IMG/M |
3300010375|Ga0105239_10906651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
3300010398|Ga0126383_12361630 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010399|Ga0134127_10317411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1508 | Open in IMG/M |
3300010403|Ga0134123_10408536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1247 | Open in IMG/M |
3300010857|Ga0126354_1162357 | Not Available | 502 | Open in IMG/M |
3300011270|Ga0137391_10705735 | Not Available | 838 | Open in IMG/M |
3300012019|Ga0120139_1043862 | Not Available | 1057 | Open in IMG/M |
3300012092|Ga0136621_1000388 | All Organisms → cellular organisms → Bacteria | 17156 | Open in IMG/M |
3300012093|Ga0136632_10218605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
3300012186|Ga0136620_10131713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1137 | Open in IMG/M |
3300012186|Ga0136620_10245183 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300012188|Ga0136618_10206022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 854 | Open in IMG/M |
3300012198|Ga0137364_10725710 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300012198|Ga0137364_11312921 | Not Available | 538 | Open in IMG/M |
3300012203|Ga0137399_10788590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 800 | Open in IMG/M |
3300012203|Ga0137399_10899024 | Not Available | 746 | Open in IMG/M |
3300012204|Ga0137374_10001120 | All Organisms → cellular organisms → Bacteria | 29810 | Open in IMG/M |
3300012204|Ga0137374_10027062 | All Organisms → cellular organisms → Bacteria | 6360 | Open in IMG/M |
3300012204|Ga0137374_10120678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 2412 | Open in IMG/M |
3300012204|Ga0137374_10454802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1004 | Open in IMG/M |
3300012204|Ga0137374_10503169 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300012204|Ga0137374_11234571 | Not Available | 521 | Open in IMG/M |
3300012211|Ga0137377_10051535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3804 | Open in IMG/M |
3300012211|Ga0137377_11029309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
3300012211|Ga0137377_11073669 | Not Available | 735 | Open in IMG/M |
3300012212|Ga0150985_119895204 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300012350|Ga0137372_10118536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2197 | Open in IMG/M |
3300012350|Ga0137372_10245835 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
3300012350|Ga0137372_11104304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. ap11 | 544 | Open in IMG/M |
3300012354|Ga0137366_10536022 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Alienimonas → Alienimonas californiensis | 843 | Open in IMG/M |
3300012355|Ga0137369_10040343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 4184 | Open in IMG/M |
3300012355|Ga0137369_10085630 | All Organisms → cellular organisms → Bacteria | 2628 | Open in IMG/M |
3300012356|Ga0137371_11235002 | Not Available | 556 | Open in IMG/M |
3300012357|Ga0137384_11581158 | Not Available | 505 | Open in IMG/M |
3300012358|Ga0137368_10060936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3124 | Open in IMG/M |
3300012359|Ga0137385_11368975 | Not Available | 571 | Open in IMG/M |
3300012362|Ga0137361_10259679 | Not Available | 1584 | Open in IMG/M |
3300012469|Ga0150984_123602966 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300012498|Ga0157345_1029857 | Not Available | 605 | Open in IMG/M |
3300012882|Ga0157304_1059008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
3300012885|Ga0157287_1075329 | Not Available | 582 | Open in IMG/M |
3300012885|Ga0157287_1102748 | Not Available | 533 | Open in IMG/M |
3300012891|Ga0157305_10056133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 860 | Open in IMG/M |
3300012896|Ga0157303_10069823 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300012897|Ga0157285_10004287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2549 | Open in IMG/M |
3300012897|Ga0157285_10177888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
3300012901|Ga0157288_10225340 | Not Available | 613 | Open in IMG/M |
3300012901|Ga0157288_10423686 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300012907|Ga0157283_10094213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
3300012907|Ga0157283_10119168 | Not Available | 735 | Open in IMG/M |
3300012909|Ga0157290_10255560 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300012914|Ga0157297_10282708 | Not Available | 616 | Open in IMG/M |
3300012930|Ga0137407_11846795 | Not Available | 576 | Open in IMG/M |
3300012943|Ga0164241_10023893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4732 | Open in IMG/M |
3300012943|Ga0164241_10478007 | Not Available | 896 | Open in IMG/M |
3300012944|Ga0137410_10224436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1463 | Open in IMG/M |
3300012951|Ga0164300_10899590 | Not Available | 559 | Open in IMG/M |
3300012951|Ga0164300_11084821 | Not Available | 522 | Open in IMG/M |
3300012957|Ga0164303_10809896 | Not Available | 645 | Open in IMG/M |
3300012961|Ga0164302_10027347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 2571 | Open in IMG/M |
3300012961|Ga0164302_10108883 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300012961|Ga0164302_11647756 | Not Available | 535 | Open in IMG/M |
3300012975|Ga0134110_10231388 | Not Available | 783 | Open in IMG/M |
3300012976|Ga0134076_10284473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 713 | Open in IMG/M |
3300012985|Ga0164308_11287312 | Not Available | 663 | Open in IMG/M |
3300012987|Ga0164307_10355011 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300013306|Ga0163162_10209192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2080 | Open in IMG/M |
3300014166|Ga0134079_10198714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
3300014325|Ga0163163_11347134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group | 775 | Open in IMG/M |
3300014326|Ga0157380_10745228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 990 | Open in IMG/M |
3300014326|Ga0157380_12388549 | Not Available | 594 | Open in IMG/M |
3300014497|Ga0182008_10127684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
3300014745|Ga0157377_10053662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2280 | Open in IMG/M |
3300014968|Ga0157379_11154499 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300014969|Ga0157376_10822025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 943 | Open in IMG/M |
3300015200|Ga0173480_10823959 | Not Available | 595 | Open in IMG/M |
3300015201|Ga0173478_10288766 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Parachlamydiales → Simkaniaceae → Simkania → Simkania negevensis → Simkania negevensis Z | 737 | Open in IMG/M |
3300015245|Ga0137409_10472587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
3300015265|Ga0182005_1175000 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300015357|Ga0134072_10089465 | Not Available | 929 | Open in IMG/M |
3300015358|Ga0134089_10412313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 579 | Open in IMG/M |
3300015358|Ga0134089_10572061 | Not Available | 503 | Open in IMG/M |
3300015371|Ga0132258_10181458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5087 | Open in IMG/M |
3300015371|Ga0132258_10752214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 2455 | Open in IMG/M |
3300015371|Ga0132258_12108950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1417 | Open in IMG/M |
3300015371|Ga0132258_12314404 | Not Available | 1347 | Open in IMG/M |
3300015371|Ga0132258_13007102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1168 | Open in IMG/M |
3300015373|Ga0132257_101280129 | Not Available | 930 | Open in IMG/M |
3300015374|Ga0132255_100323026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2228 | Open in IMG/M |
3300015374|Ga0132255_101635043 | Not Available | 976 | Open in IMG/M |
3300015374|Ga0132255_103672549 | Not Available | 652 | Open in IMG/M |
3300015374|Ga0132255_104687617 | Not Available | 579 | Open in IMG/M |
3300016387|Ga0182040_10839477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 759 | Open in IMG/M |
3300017657|Ga0134074_1117421 | Not Available | 919 | Open in IMG/M |
3300017659|Ga0134083_10333050 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300017787|Ga0183260_10136728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1753 | Open in IMG/M |
3300017789|Ga0136617_10029240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4912 | Open in IMG/M |
3300017789|Ga0136617_10070549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3058 | Open in IMG/M |
3300017792|Ga0163161_10715332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
3300017944|Ga0187786_10021292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1723 | Open in IMG/M |
3300017944|Ga0187786_10607968 | Not Available | 514 | Open in IMG/M |
3300017959|Ga0187779_10217432 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300017965|Ga0190266_10018265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1995 | Open in IMG/M |
3300017965|Ga0190266_10175570 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Alienimonas → Alienimonas californiensis | 995 | Open in IMG/M |
3300017966|Ga0187776_10325469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1007 | Open in IMG/M |
3300017966|Ga0187776_10679620 | Not Available | 726 | Open in IMG/M |
3300017966|Ga0187776_10734693 | Not Available | 702 | Open in IMG/M |
3300017997|Ga0184610_1265869 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300018027|Ga0184605_10160731 | Not Available | 1013 | Open in IMG/M |
3300018032|Ga0187788_10339519 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300018053|Ga0184626_10147370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
3300018054|Ga0184621_10158121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 816 | Open in IMG/M |
3300018056|Ga0184623_10078780 | Not Available | 1517 | Open in IMG/M |
3300018058|Ga0187766_10096939 | Not Available | 1783 | Open in IMG/M |
3300018060|Ga0187765_10013757 | All Organisms → cellular organisms → Bacteria | 3718 | Open in IMG/M |
3300018063|Ga0184637_10277455 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300018064|Ga0187773_10543737 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300018089|Ga0187774_10975448 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300018422|Ga0190265_10003115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11302 | Open in IMG/M |
3300018422|Ga0190265_10091074 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
3300018422|Ga0190265_10410865 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
3300018422|Ga0190265_13833768 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa | 501 | Open in IMG/M |
3300018429|Ga0190272_10820298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 860 | Open in IMG/M |
3300018429|Ga0190272_13142979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300018465|Ga0190269_10073183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 1622 | Open in IMG/M |
3300018465|Ga0190269_11490769 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300018466|Ga0190268_10084038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1416 | Open in IMG/M |
3300018466|Ga0190268_10316283 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Alienimonas → Alienimonas californiensis | 948 | Open in IMG/M |
3300018469|Ga0190270_10243845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1557 | Open in IMG/M |
3300018469|Ga0190270_10477339 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300018469|Ga0190270_10880372 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300018469|Ga0190270_12866012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 545 | Open in IMG/M |
3300018476|Ga0190274_12827334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 582 | Open in IMG/M |
3300018481|Ga0190271_10058333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 3335 | Open in IMG/M |
3300019356|Ga0173481_10002907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4383 | Open in IMG/M |
3300019356|Ga0173481_10009475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2716 | Open in IMG/M |
3300019356|Ga0173481_10017208 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
3300019356|Ga0173481_10034152 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
3300019767|Ga0190267_10401408 | Not Available | 765 | Open in IMG/M |
3300019767|Ga0190267_10894148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 606 | Open in IMG/M |
3300019767|Ga0190267_10985914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300020070|Ga0206356_10221829 | Not Available | 600 | Open in IMG/M |
3300020075|Ga0206349_1925828 | Not Available | 595 | Open in IMG/M |
3300021445|Ga0182009_10224864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 923 | Open in IMG/M |
3300021445|Ga0182009_10624127 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300022737|Ga0247747_1018883 | Not Available | 747 | Open in IMG/M |
3300022737|Ga0247747_1048938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300022883|Ga0247786_1119324 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300022886|Ga0247746_1035932 | Not Available | 1115 | Open in IMG/M |
3300022889|Ga0247785_1010856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 942 | Open in IMG/M |
3300022893|Ga0247787_1003950 | Not Available | 1641 | Open in IMG/M |
3300022893|Ga0247787_1028760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
3300023064|Ga0247801_1025564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 820 | Open in IMG/M |
3300023066|Ga0247793_1003877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 2030 | Open in IMG/M |
3300023072|Ga0247799_1005546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1767 | Open in IMG/M |
3300023263|Ga0247800_1011431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1368 | Open in IMG/M |
3300024055|Ga0247794_10014852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1863 | Open in IMG/M |
3300024055|Ga0247794_10055018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1100 | Open in IMG/M |
3300024055|Ga0247794_10088593 | Not Available | 906 | Open in IMG/M |
3300025315|Ga0207697_10531644 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Alienimonas → Alienimonas californiensis | 518 | Open in IMG/M |
3300025898|Ga0207692_10690777 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300025899|Ga0207642_10429571 | Not Available | 796 | Open in IMG/M |
3300025901|Ga0207688_10045862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 2439 | Open in IMG/M |
3300025901|Ga0207688_11102597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
3300025903|Ga0207680_11135421 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300025906|Ga0207699_10382936 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300025908|Ga0207643_10053408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2296 | Open in IMG/M |
3300025908|Ga0207643_10054433 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
3300025908|Ga0207643_10221692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1158 | Open in IMG/M |
3300025910|Ga0207684_10253282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1519 | Open in IMG/M |
3300025910|Ga0207684_11590616 | Not Available | 529 | Open in IMG/M |
3300025913|Ga0207695_11357280 | Not Available | 591 | Open in IMG/M |
3300025918|Ga0207662_10192400 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → unclassified Synergistales → Synergistales bacterium 54_24 | 1317 | Open in IMG/M |
3300025918|Ga0207662_11193983 | Not Available | 541 | Open in IMG/M |
3300025925|Ga0207650_10009966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6503 | Open in IMG/M |
3300025925|Ga0207650_11866587 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300025927|Ga0207687_10066944 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWB1_56_8 | 2554 | Open in IMG/M |
3300025927|Ga0207687_10497240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1017 | Open in IMG/M |
3300025927|Ga0207687_11141949 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300025928|Ga0207700_10272950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1452 | Open in IMG/M |
3300025937|Ga0207669_10597676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 896 | Open in IMG/M |
3300025938|Ga0207704_10284658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1258 | Open in IMG/M |
3300025945|Ga0207679_10937739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 792 | Open in IMG/M |
3300025945|Ga0207679_11357535 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300025949|Ga0207667_10102587 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
3300025986|Ga0207658_11637578 | Not Available | 588 | Open in IMG/M |
3300026023|Ga0207677_10663571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 922 | Open in IMG/M |
3300026041|Ga0207639_10057670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2983 | Open in IMG/M |
3300026075|Ga0207708_10001657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16568 | Open in IMG/M |
3300026078|Ga0207702_10263317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1624 | Open in IMG/M |
3300026089|Ga0207648_10530570 | Not Available | 1079 | Open in IMG/M |
3300026095|Ga0207676_10068843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 2832 | Open in IMG/M |
3300026095|Ga0207676_10356434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1354 | Open in IMG/M |
3300026330|Ga0209473_1315605 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300026335|Ga0209804_1269739 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa | 604 | Open in IMG/M |
3300026550|Ga0209474_10220317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
3300026550|Ga0209474_10402184 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300026550|Ga0209474_10707628 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300027691|Ga0209485_1178364 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300027750|Ga0209461_10156617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300027821|Ga0209811_10222699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
3300027909|Ga0209382_11350354 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300028563|Ga0265319_1233058 | Not Available | 562 | Open in IMG/M |
3300028577|Ga0265318_10189646 | Not Available | 752 | Open in IMG/M |
3300028587|Ga0247828_10781670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 603 | Open in IMG/M |
3300028589|Ga0247818_10395111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. ap11 | 931 | Open in IMG/M |
3300028596|Ga0247821_10089255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1723 | Open in IMG/M |
3300028784|Ga0307282_10017374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2979 | Open in IMG/M |
3300028791|Ga0307290_10033968 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300028807|Ga0307305_10003133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6893 | Open in IMG/M |
3300028807|Ga0307305_10447712 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300028814|Ga0307302_10264753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 843 | Open in IMG/M |
3300028819|Ga0307296_10024990 | Not Available | 3151 | Open in IMG/M |
3300028824|Ga0307310_10114970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1211 | Open in IMG/M |
3300028824|Ga0307310_10565404 | Not Available | 577 | Open in IMG/M |
3300028884|Ga0307308_10038386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2242 | Open in IMG/M |
3300028889|Ga0247827_10300900 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300028889|Ga0247827_10904808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
3300031226|Ga0307497_10425550 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300031366|Ga0307506_10097246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 959 | Open in IMG/M |
3300031546|Ga0318538_10175657 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300031576|Ga0247727_10007207 | All Organisms → cellular organisms → Bacteria | 21353 | Open in IMG/M |
3300031576|Ga0247727_10260705 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300031576|Ga0247727_10492347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 955 | Open in IMG/M |
3300031719|Ga0306917_11060797 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300031751|Ga0318494_10568118 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300031771|Ga0318546_11038177 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031781|Ga0318547_11028194 | Not Available | 515 | Open in IMG/M |
3300031846|Ga0318512_10673042 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300031847|Ga0310907_10488654 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300031903|Ga0307407_11400459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
3300031939|Ga0308174_10037417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3187 | Open in IMG/M |
3300031941|Ga0310912_10765807 | Not Available | 747 | Open in IMG/M |
3300031965|Ga0326597_11761964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
3300031996|Ga0308176_10026026 | All Organisms → cellular organisms → Bacteria | 4487 | Open in IMG/M |
3300032002|Ga0307416_101432603 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300032013|Ga0310906_10225498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1154 | Open in IMG/M |
3300032013|Ga0310906_10519716 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300032013|Ga0310906_10614650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
3300032013|Ga0310906_10704307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
3300032076|Ga0306924_11991694 | Not Available | 599 | Open in IMG/M |
3300032159|Ga0268251_10000043 | All Organisms → cellular organisms → Bacteria | 123169 | Open in IMG/M |
3300032770|Ga0335085_10021154 | All Organisms → cellular organisms → Bacteria | 9271 | Open in IMG/M |
3300032782|Ga0335082_10302401 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
3300032828|Ga0335080_10000098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 75579 | Open in IMG/M |
3300032829|Ga0335070_10076310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 3580 | Open in IMG/M |
3300032829|Ga0335070_10249286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1741 | Open in IMG/M |
3300032892|Ga0335081_10137736 | All Organisms → cellular organisms → Bacteria | 3523 | Open in IMG/M |
3300032893|Ga0335069_10053197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5296 | Open in IMG/M |
3300032893|Ga0335069_11825626 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300032955|Ga0335076_10074148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3348 | Open in IMG/M |
3300033004|Ga0335084_11998101 | Not Available | 565 | Open in IMG/M |
3300033412|Ga0310810_10479937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1246 | Open in IMG/M |
3300033475|Ga0310811_11251552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
3300033550|Ga0247829_10181868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1659 | Open in IMG/M |
3300034195|Ga0370501_0012972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2323 | Open in IMG/M |
3300034660|Ga0314781_035520 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300034661|Ga0314782_031778 | Not Available | 967 | Open in IMG/M |
3300034671|Ga0314796_079068 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300034674|Ga0314799_025154 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300034678|Ga0314803_055042 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.55% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.36% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.09% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.86% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.73% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.27% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.27% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.50% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.59% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.14% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.45% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.45% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.45% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.45% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.23% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.23% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.23% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.23% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.23% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.23% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.23% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.23% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.23% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.23% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.23% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.23% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.23% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034674 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L02_01645090 | 2170459007 | Grass Soil | LVRLAARPNPVPRPAKVVQLDARREARFEAARPDRSRPRPAA |
JGI10214J12806_111864553 | 3300000891 | Soil | MHRHLHIVRLVPPRPVRAERPAKVIVLEVRRKAPLEAARPERQPPRDAA* |
JGI1027J12803_1021604371 | 3300000955 | Soil | MHLHLVRVAARPKQAAGRPAKVVALEARRKARLEADRQR |
JGI10216J12902_1037807223 | 3300000956 | Soil | REENEMHLHLVRLTARPELPLRPAKVIVLETRRKARLDTVKPERPAPRPAA* |
C688J35102_1206816365 | 3300002568 | Soil | MHLHLVQVAARPKQALRPARPAKVVQLEARRKARLAAARPERQPPRAAA* |
soilL1_101118412 | 3300003267 | Sugarcane Root And Bulk Soil | MHLHLVKVVARPQALRPAKVVSLEVRRKARLQRPRPTRPAKPAA* |
Ga0058689_101327522 | 3300004016 | Agave | LVRVAARPKRPFRPAKVVVLETRRKARLEAARPERQPPRPAA* |
Ga0063454_1015160951 | 3300004081 | Soil | MHLHLVKVVARPKALRPAKVVSLEVRRKARLEASLPKLPPKAA* |
Ga0062589_1005604832 | 3300004156 | Soil | MHLHMVRVAARPKAQAVRPAKVVSLEVRRKARLEAAAPRPP |
Ga0062590_1029056011 | 3300004157 | Soil | MHLHLVRLTARPELPLRPAKVIVLETRRKARLDTVKPERPAPRPAA* |
Ga0063356_1007241342 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MHRHLHIVRLVPPRPVRPERPAKVIVLDVRRKARLEAARPERQPPRDAA* |
Ga0062595_1001860885 | 3300004479 | Soil | MHLHLVRVAKLPKQLQRPAKVVQLEVRRQARAERALRERSHPRPAA* |
Ga0062592_1013010922 | 3300004480 | Soil | APFTTRGDEMHLHLVRVVARPQPLPRPAKVIVLEVRRKARLEASRPPRQPSRPAA* |
Ga0062592_1013214313 | 3300004480 | Soil | MNLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPTRPAA* |
Ga0062591_1015274863 | 3300004643 | Soil | MHLHLVRVAARPKQAPRPAKVVVLETRRKARLEAARPERSGPRPAA* |
Ga0058859_116682661 | 3300004798 | Host-Associated | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAAR |
Ga0062594_1017097971 | 3300005093 | Soil | EESDMHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARRECERPRPAA* |
Ga0066683_108235851 | 3300005172 | Soil | HLVRVAARPKPVPRPAKVVQLEARRKARLDAARPQRQPPRPAA* |
Ga0066690_110359053 | 3300005177 | Soil | MHLHLVRVAARPKYVPRPAKVVQLEVRRKARLEAARPERLAPRPAA* |
Ga0066684_101440372 | 3300005179 | Soil | MHLHLVRVAARPKQPLRPAKVVVLESRRKARLEASQPERPRPRPAA* |
Ga0066684_106351041 | 3300005179 | Soil | MHLHLVRVAARPKPVPRPAKVVQLEARREARLDAARPQRQPPRPAA* |
Ga0066678_102284815 | 3300005181 | Soil | MHLHLVRVAARPKPVPRPKVVRLEDRRKARLEAARRDRPRPPRPAA* |
Ga0066671_103865963 | 3300005184 | Soil | MHLHLVRVAARPKYVPRPAKVVQLEVRRKARLEAARPERPAPRPAA* |
Ga0070676_101651612 | 3300005328 | Miscanthus Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLERQHPRPAA* |
Ga0070683_1001008405 | 3300005329 | Corn Rhizosphere | MHRHLHIVRLVPPRPVRAERPAKVIVLEVRRKARLEAARPERQPPRDAA* |
Ga0070683_1001265472 | 3300005329 | Corn Rhizosphere | MHLHLVRLAARPNDVPRPAKVVQLEARREARLQPRRSKWQPTRPAA* |
Ga0070683_1001423422 | 3300005329 | Corn Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPERQPPRDAA* |
Ga0070683_1003126071 | 3300005329 | Corn Rhizosphere | MHLHLVRVATRPTQAVARPAKVVALDSRRKARLEAARLQRQRPRPAA* |
Ga0070683_1006557961 | 3300005329 | Corn Rhizosphere | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQRPRPAA* |
Ga0070683_1006784023 | 3300005329 | Corn Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLEQQHPRPAA* |
Ga0070690_1003466851 | 3300005330 | Switchgrass Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARLDAARLERQHPRPAA* |
Ga0066388_1006528475 | 3300005332 | Tropical Forest Soil | MHLHLVRLLPRPAHVPVPRPAKVVQLEARRQARLEAERPQPQPPIRPAA* |
Ga0066388_1008846193 | 3300005332 | Tropical Forest Soil | MHLHLVRVAARPEQVLRPAKVVALDARRKARLEAARRERSRPRPAA* |
Ga0068869_1004604133 | 3300005334 | Miscanthus Rhizosphere | MHRHLHIVRLVPPRPVRAERPAKAIVLEVRRKARLEAARPERQPPRDAA* |
Ga0070666_101638322 | 3300005335 | Switchgrass Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPERQPPLDAA* |
Ga0068868_1002257201 | 3300005338 | Miscanthus Rhizosphere | EMHLHLVRLAARPNDVPRPAKVVQLEARREARLQPRRSKWQPTRPAA* |
Ga0068868_1003312722 | 3300005338 | Miscanthus Rhizosphere | MHLHLVRVVTRPTQAVARPAKVVALDSRRKARLEAARQRERQRPRPAA* |
Ga0070691_105045281 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARLEAARRESERPRPAA* |
Ga0070691_106982722 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVASRPKQAQRPAKVVQLETRRQARLERQRLERHRPRPAA* |
Ga0070687_1015044144 | 3300005343 | Switchgrass Rhizosphere | APRAPFDREEREMHRHLMLVVARPNPAPRPAKVVLLEARRKARLEASRPQPPRAA* |
Ga0070661_1014996382 | 3300005344 | Corn Rhizosphere | MHQHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLERQHPRPAA* |
Ga0070692_103874452 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQSPRPAA* |
Ga0070709_101045562 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVAARPKQPSRPAKVVVLEARRRARLELARPERQPPRPAA* |
Ga0070714_1005663692 | 3300005435 | Agricultural Soil | MHRHLMLVTARPKETLRPAKVIVLESRRKARLETAWHERHRPRPAA* |
Ga0070714_1008920521 | 3300005435 | Agricultural Soil | MHLHLVRVAARPAQVARPAKVIVLETRRKARLEASRPQPRQPRPAA* |
Ga0070713_1005988755 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVAKQPVELQRQAKVVQLEARRQARLEAALRERSRPRPAA* |
Ga0070701_101854983 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRHLHIVRLVPPRPVRPERPAKVIVLEARRKARLEAARPERQPPRDAA* |
Ga0070705_1002634032 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLE |
Ga0070700_1014408422 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLPTREESDMHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQSPRPAA |
Ga0070708_1000239602 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVAVRPKPVRRPKVVRLEDRRKARLATAPRDRPCPPRPAA* |
Ga0070708_1000359446 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRLAARPKPVPRPAKVVQLDARREARLEAARRERSRPRPAA* |
Ga0066682_105138512 | 3300005450 | Soil | MHLHLVRVAARPTPVPRPAKVVQLEARRKARLEAERPKRPRPRPAA* |
Ga0070706_1006266314 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVAARPKRVPRPAKVVQLDVRRKARLELARPHRQPPGPAA* |
Ga0070706_1016428161 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DREEAEMHLHLVRLAARPKPVPRPAKVVQLDARREARLEAARRERSRPRPAA* |
Ga0070698_1004557082 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARLERQHPRPAA* |
Ga0070698_1012678943 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVAAPPKGPRPAKVVSLEVRRQARLEAARPKRPAPRPAA* |
Ga0070699_1006748651 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRPSRQRGPEMHLHLVRIAARPKPAPRPAKVVVLETRRKARLEAARPERQPAA* |
Ga0070699_1007098922 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHIVRVAARPLPQPRPAPRPAKVIVLEARRQARLEAARPERQRPRPAA* |
Ga0070699_1016933952 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVVARPQPPRPAKVVVLETRRKAHLEAVRPQPTAPRPAA* |
Ga0073909_105487411 | 3300005526 | Surface Soil | ERGERMHLHLVRVVARPKPEPPRPSKVVCLDARRKARLEALRPHRPPTRPAAA* |
Ga0070741_10000289119 | 3300005529 | Surface Soil | MHQHLYVVRTAAQPKQPRPAKVVQLDVRRKERREALRPQRHPSPPAA* |
Ga0070741_100391503 | 3300005529 | Surface Soil | MHLNLVKVVARPQALRPAKVVSLEVRRRARLESAGAKRPPKRAA* |
Ga0070741_106336382 | 3300005529 | Surface Soil | MHLHLVKVVARPKALRPAKVVSLEVRRKARLESVRRKQPPKTAA* |
Ga0070679_1000795652 | 3300005530 | Corn Rhizosphere | MHLHLARVAAPPRRAPRPAKVIQLETRRQARLERARPERQPPRTAA* |
Ga0070679_1004947345 | 3300005530 | Corn Rhizosphere | MHLHLVRIAARPKQVPRPAKVVQLDVRREARLEAARPRRQPPKPAA* |
Ga0070696_1008633833 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVAARPKPVQRPKVVRLDDRRKARLEAARRDRPRPPRPAA* |
Ga0070693_1002884032 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVVARPKDVLRPAKVVQLEARREARLQPRRSKWQPPRPAA* |
Ga0070704_1004396891 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWERPRPAA* |
Ga0066701_107569952 | 3300005552 | Soil | VSALRDREEAEMHLHLVRVAARPKPVPRPAKVVQLEARRKARLDAARPQRQPPRPAA* |
Ga0066695_102500776 | 3300005553 | Soil | MHLHLVRVAARPKQVPRPAKVVQLEARRKARLEAERPKRPRPRPAA* |
Ga0066704_105831345 | 3300005557 | Soil | EMHLHLVRVAPSTKQGQRPAKVVQLEARRKARLEAARPKRQPPRAAA* |
Ga0066698_105593261 | 3300005558 | Soil | MHLHLVQVAARPKQVPRPAKVVQLEARRKARLEAARPKRQPPRPAA* |
Ga0066670_100465445 | 3300005560 | Soil | MHLHVVRVAARPKQPLRPAKVVVLDVRRKARLEASRPERQPPRPAA* |
Ga0058697_1000012614 | 3300005562 | Agave | MHLHLVRVAARPKRPFRPAKVVVLETRRKARLEAARPERQPPRPAA* |
Ga0066705_109047631 | 3300005569 | Soil | MHLHLVRVAARPKQAPRPAKVVQLEVRRKARLEAADRSGRPTAGRVND |
Ga0068856_1006435691 | 3300005614 | Corn Rhizosphere | REEAEMHLHLVRIAARPKQVPRPAKVVQLDVRREARLEAARPRRQPPKPAA* |
Ga0068856_1011212994 | 3300005614 | Corn Rhizosphere | REEAEMHLHLVRVVARPKVGPRPAKVVQLEARRHARHEAARPERPRPRPAA* |
Ga0068856_1024249952 | 3300005614 | Corn Rhizosphere | MQRHLVRVAARPAQVARPAKVIVLETRRKARLEASRPQPREPRPAA* |
Ga0070702_1018307662 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVAARPEQAPRPAKVIVLEARRKARLEAARRDAQRPRPAA* |
Ga0066905_1001842111 | 3300005713 | Tropical Forest Soil | MHLHLVRLATLPTKEGRRPAKVVQLEARRQARLERQRPERPDQPDRR |
Ga0066905_1009120152 | 3300005713 | Tropical Forest Soil | MHLHLVRVTARPKPPRPAKVVVLQTRQKTRLERHDPKLLPPRTAA* |
Ga0068866_101892452 | 3300005718 | Miscanthus Rhizosphere | MHLHLVRVVTRPTQAVARPAKVVALDSRRKARLEADRLRERQRPRPAA* |
Ga0068861_1019725201 | 3300005719 | Switchgrass Rhizosphere | RRDYLHDVRGGAVMHRHLHIVRLVPPRPVRPERPAKVIVLDVRRKARLEAARPERQPPRDAA* |
Ga0066903_1009748871 | 3300005764 | Tropical Forest Soil | MHLHLVRVVARPKPQAPRPSKVVCLDARRKARLEALRPTPPPTRPAA* |
Ga0066903_1018948241 | 3300005764 | Tropical Forest Soil | MHLHLVRVATRPTQAVARPAKVVALESRRKARLEAARLQRQRPRPAA |
Ga0066903_1019103993 | 3300005764 | Tropical Forest Soil | MHLHLVRVAKRPQTVRRPAKVVVLETRRKARLERSRPQPRSAA* |
Ga0066903_1029012035 | 3300005764 | Tropical Forest Soil | FDREEHEMPRHLIRVVPRPQKPRPAKVVQLDVRRKARLEASRPVPPHQRPAA* |
Ga0066903_1039581141 | 3300005764 | Tropical Forest Soil | MHLHLVRVTARPKPPRPAKVVVLQTRQKTRLERHDPKLHPPRTAA* |
Ga0066903_1059446082 | 3300005764 | Tropical Forest Soil | MHLHLVRVVARPAPVRPAKVVLLEARRKARLEKQRPQRQPPRPAA* |
Ga0066903_1086987481 | 3300005764 | Tropical Forest Soil | MHLHVVRVAARPKQPPRPAKVIVLESRRKARLEAARPERSGPRPAA* |
Ga0068863_10006896314 | 3300005841 | Switchgrass Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVILLDVRRKARLEAARPERQPPRDAA* |
Ga0070717_102028392 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRHLVRVAARPAQVARPAKVIVLETRRKARLEASRPQPRQPRPAA* |
Ga0066651_103787582 | 3300006031 | Soil | MHLHLVRVVTRPPQAVARPAKVVALDSRRKARLEAARQHEPRRPRPAA* |
Ga0066652_1001421032 | 3300006046 | Soil | MHLHLVRVAARPKQVPRPSKVVQLEARRQARLEAARPQRQPPRPAA* |
Ga0066652_1003760331 | 3300006046 | Soil | MHLHLVRVVTRPPQAVARPAKVVALDSRRKARLEAARQHERQRPRPAA* |
Ga0066652_1007562992 | 3300006046 | Soil | VSALRTREEAEMHLHLVRVAARPKPVLRPAKVIQLEARRKAGLAAERPQRQPPRPAA* |
Ga0066652_1012382824 | 3300006046 | Soil | MHLHLVRVVARPKAPPRPAKVVVLETRRKARLELMRPERQPPRPAA* |
Ga0075432_100721763 | 3300006058 | Populus Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPDRQPPRDAA* |
Ga0075422_102609452 | 3300006196 | Populus Rhizosphere | MHLHIVRVAARPRFAPRPAPRPAKVIVLETRRQARIEAARREWQRPRPAA* |
Ga0074049_127564872 | 3300006580 | Soil | LEGAASALRDREEAEMHLHLVRVTARPKPVLRPAKVVQLDARRKARLETARRDRPGPRPAA* |
Ga0079222_102847912 | 3300006755 | Agricultural Soil | MHLHLVRVAARPKPVPRPKVVRLEDRRKARLEPARRDRLRPPRLAA* |
Ga0066659_109953801 | 3300006797 | Soil | AARPMKPPRPAKVVLLEVRRKARLEAERPERQPPRPAA* |
Ga0066659_110625971 | 3300006797 | Soil | MHLHLVRVAKQPKRLQRPAKVVQLEARRQARLEAALRDRSRPRPAA* |
Ga0079220_104630402 | 3300006806 | Agricultural Soil | MHLHLVKVVARPHALRPAKVVSLEVRRKARLQRPRPTRPAKPAA* |
Ga0079220_114535901 | 3300006806 | Agricultural Soil | MHLHLIRVAARPEPKPVQRPAQVVRLDVRRKARLEAERLEAQRPRPAA* |
Ga0075428_1012946192 | 3300006844 | Populus Rhizosphere | MHRHLVLVAARPKRLPRPAKVVMLEARRKARLEAARAERQRPRPAA* |
Ga0075433_101636506 | 3300006852 | Populus Rhizosphere | RRNYLHDVRGGAVMHRHLHIVRLVPPRPVRPERPAKVIVLDVRRKARLEAARPERQPPRDAA* |
Ga0075433_106560274 | 3300006852 | Populus Rhizosphere | MHLHIVRVAARPLPQPRPAPRPAKVIVLEARRQARIEAARREWQSPRPAA* |
Ga0075433_112682593 | 3300006852 | Populus Rhizosphere | MHLHLVRVVARPQPLPRPAKVIVLEVRRKARLEASRPPRQPSRPAA* |
Ga0075420_1016830601 | 3300006853 | Populus Rhizosphere | LSGAPRGATRREETEMHLHLVRLTARPELPLRPAKVIVLETRRKARLDTVKPERPAPRPAA* |
Ga0075425_1020080523 | 3300006854 | Populus Rhizosphere | GGARANHREESEMHLHLVRVASRPKQVQRPAKVVQLEARRQARLERQRQERPEPRPAA* |
Ga0079217_100088382 | 3300006876 | Agricultural Soil | MHLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPPRPAA* |
Ga0075429_1009431323 | 3300006880 | Populus Rhizosphere | RQRGPEMHLHLVRIAARPKQAPRSAKVIVLETRRKARLDSMRPERQPPRPAA* |
Ga0068865_1003911773 | 3300006881 | Miscanthus Rhizosphere | MHLHIVRVAARPGLEPRPAPRPAKVIVLEARRQARIEAERLERQHPRPAA* |
Ga0079215_100943785 | 3300006894 | Agricultural Soil | MHRHLVRVAARPQEATRPAKVVVLETRRKARLEALRSEQTRPRPAA* |
Ga0075424_1003611541 | 3300006904 | Populus Rhizosphere | GARANHREESEMHLHLVRVASRPKQVQRPAKVVQLEARRQARLELQRQERPEPRPAA* |
Ga0075424_1007490652 | 3300006904 | Populus Rhizosphere | MHLHLVRVAKQPMELQRQAKVVQLEARRQARLEAALRERSRPRPAA* |
Ga0075424_1026334362 | 3300006904 | Populus Rhizosphere | MHLHLVRVATRPTQAVARPAKVVALDSRRKARLEAARLQRQ |
Ga0074063_139624683 | 3300006953 | Soil | MHRHLTVVVARPKETQRPAKVIVLESRRKARLETAWHERHRPRPAA* |
Ga0079219_114123461 | 3300006954 | Agricultural Soil | MYLRLVRVAVQPEQQPQVQRPAKVVQLEARRKAREERRAQWQPPRAAA* |
Ga0075419_101993302 | 3300006969 | Populus Rhizosphere | MHLHIVRVAARPLPQPRPAPRPAKVIVLEARRQARIEAAQPERQRPRPAA* |
Ga0079218_121531482 | 3300007004 | Agricultural Soil | MHLHLVRVAARPKQPQRPANLVVLESRRQARLDAARSKRQPTRPAA* |
Ga0066710_1009032926 | 3300009012 | Grasslands Soil | MHLHLVRVVARPKAPPRPAKVVVLETRRKARLELMRPERQPPRPAA |
Ga0066710_1033126004 | 3300009012 | Grasslands Soil | EGAARALRDREEAEMHLHLVRVAARPKQVVPRPAKVVQLEARRKARLEAARPKRQPPRPA |
Ga0105240_106764323 | 3300009093 | Corn Rhizosphere | MHRHLHIVRLVPPRPVRPERPAKVIVLDVRRKARLEAARPERQPPRPAA* |
Ga0111539_102712362 | 3300009094 | Populus Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEGARPERQPPRDAA* |
Ga0111539_114978602 | 3300009094 | Populus Rhizosphere | EESDMHLHIVRVAARPLPQPRPAPRPAKVIVLEARRQARIEAAQPERQRPRPAA* |
Ga0111539_119702133 | 3300009094 | Populus Rhizosphere | REMHRHLHVVRLLPPRPVRAERPAKVIVLEVRRKERLEAARPERQPPRDAA* |
Ga0105245_101671775 | 3300009098 | Miscanthus Rhizosphere | MHRHLHIVRLVPPRPVRAERPAKAIILEVRRKARLEAARPERQPPRDAA* |
Ga0105245_122345461 | 3300009098 | Miscanthus Rhizosphere | MHLHLVRVATRPTQAVARPAKVVALDSRRKARLEAARQRERQRPRPAA* |
Ga0075418_100540667 | 3300009100 | Populus Rhizosphere | MHLHIVRVAARPLPQPRPAPRPAKVIVLEARRQARIEAARPERQRPRPAA* |
Ga0105247_105435062 | 3300009101 | Switchgrass Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLERQHPRPA |
Ga0066709_1034603211 | 3300009137 | Grasslands Soil | MHLHLVRVTARRKPPRPAKVVQLEARRQARLEAARPQRPPSRPAA* |
Ga0066709_1044928052 | 3300009137 | Grasslands Soil | MHKHFVRVAARPKQAPRPAKIVQLEVRRKARLESARPQRQP |
Ga0114129_1031294112 | 3300009147 | Populus Rhizosphere | MNLHLVRVTARPKRPLRPAKVIVLETRRKARLEAMRSERQPPPLRPAA* |
Ga0114129_107422344 | 3300009147 | Populus Rhizosphere | TREESDMHLHIVRVAARPLPQPRPAPRPAKVIVLEARRQARIEAAQPERQRPRPAA* |
Ga0114129_121159822 | 3300009147 | Populus Rhizosphere | MHLHLVRVAARPKPAPRPSKVVRLEDRRKARLEAARRDRPRP |
Ga0105243_125342653 | 3300009148 | Miscanthus Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVILLDVRRKARLEAAR |
Ga0111538_123828902 | 3300009156 | Populus Rhizosphere | MHRHLHVVRLLPPRPVRAERPAKVIVLEVRRKERLEAARPERQPPRDAA* |
Ga0111538_127283481 | 3300009156 | Populus Rhizosphere | IVRLVPPRPVRAERPAKAIVLEVRRKARLEAARPERQPPRDAA* |
Ga0105248_104371562 | 3300009177 | Switchgrass Rhizosphere | MHLHLVRVVARPKDVPRPAKVVQLEARREARLQPRRFKWQPPRPAA* |
Ga0105248_128869532 | 3300009177 | Switchgrass Rhizosphere | VRVATRPTQAVARPAKVVALDSRRKARLEAARLQRQRPRPAA* |
Ga0105237_120759881 | 3300009545 | Corn Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARREWQSPRPAA* |
Ga0126307_1001081810 | 3300009789 | Serpentine Soil | MHLHLVRVVARPKQAPRPAKVVVLATRRQARLEQARRERQTPRPAA* |
Ga0126307_100809828 | 3300009789 | Serpentine Soil | MHLHLVRVAARPKQVPRPAKVVQFDVRRKARLKAARPERPRPRPAA* |
Ga0126307_109078683 | 3300009789 | Serpentine Soil | MQLHLVRVAARPKQPHRPAKVVVLESRRQARLDAARSKRQPPRPAA* |
Ga0126307_110212341 | 3300009789 | Serpentine Soil | MHLHLVRIAARPKQVPRPAKVVVRETRRKARLDSMRPERQPPRQAA* |
Ga0126374_110065072 | 3300009792 | Tropical Forest Soil | MHLHLVRVAARPEPVQRPAKVVQLDVRRKARLEAERLEAQRPRPAA* |
Ga0105075_10451481 | 3300009799 | Groundwater Sand | MHLHLVRVAARPKQAPRPAKVVVLETRRKARLEAARPERPAPR |
Ga0126313_101006062 | 3300009840 | Serpentine Soil | MHRHLVLVVARPQRLPRPAKVVVLDARRKARLEAARPERQRPRPAA* |
Ga0131077_1001449629 | 3300009873 | Wastewater | MHQHLHLHLVRLVRPRPMRPHRPAQVIDLEARRKARREAARPERQPPRAAA* |
Ga0131077_108679791 | 3300009873 | Wastewater | MHRHLHVVRLVPPRPVRVERSAKVIVLDARRKARLEAVRPERQPPRDAA* |
Ga0126304_100468606 | 3300010037 | Serpentine Soil | MHLHLVRVVARPKQAPRPAKVVVLATRRQARLEQARRERQTPRPVA* |
Ga0126304_103338234 | 3300010037 | Serpentine Soil | MNLHLVRVAARLKQQRPAKVVVLETRRKARLDTVKPERPAPRPAA* |
Ga0126304_105251222 | 3300010037 | Serpentine Soil | MHLHLVRVAARPKQVPRPAKVVQLEVRRKARLEPVRHKRPRPRPAA* |
Ga0126315_101237431 | 3300010038 | Serpentine Soil | TTQRGDEMHRHLVLVVARPKRLPRPAKVVLLDARRKARLEAARPERQRPRPAA* |
Ga0126315_105363845 | 3300010038 | Serpentine Soil | LVLVAARPKPLRPLRPAKVVSLEARRRARLEASRPEPPTRSAA* |
Ga0126308_108175931 | 3300010040 | Serpentine Soil | MHRHLVLVAARPKPLRPLRPAKVVSLEARRRARLEASRPKPPTRSAA* |
Ga0126312_108864542 | 3300010041 | Serpentine Soil | MHLHLVPVKARPKQVPRPAKVVQLEARRKARLEAARPERQPPRPAA* |
Ga0126314_111302701 | 3300010042 | Serpentine Soil | MHRHLVLVVARPNSPAPRPAKVVSLEARRRARLEASRPKPS |
Ga0126310_107460401 | 3300010044 | Serpentine Soil | MHRHLVLVVARPKRLPRPAKVVVLDARRKARLEAARPERQRPRPAA* |
Ga0126311_112587162 | 3300010045 | Serpentine Soil | MHLHLVRVAVRPKQAPRPAKVIVLATRRKARLEAARPERQPPRPAA* |
Ga0126311_114216732 | 3300010045 | Serpentine Soil | MHRHLVPVVARPKRLPRPAKVVLLDARRKARLEAARPERQHPRPAA* |
Ga0127498_10427261 | 3300010124 | Grasslands Soil | MHLHLVRVAARPKQAPRPAKVIVLETRRKARLEAARPQRQPPRPA |
Ga0126318_110888181 | 3300010152 | Soil | MHLHLARVAAPPRRAPRPAKVIQLETRREARLERARPERQPPRTAA* |
Ga0126306_108387412 | 3300010166 | Serpentine Soil | MHLHLVRIAARPKQVPRPAKVVVLETRRKARLDSMRPERQPPRQAA* |
Ga0134082_101875605 | 3300010303 | Grasslands Soil | RDREEHAMHLHLVRVAARPKQVPRATKVVQLDVRREARLETARRDTQQPRPAA* |
Ga0134067_104006711 | 3300010321 | Grasslands Soil | MHLHLVRVAARPPKPLPRPAKVVVLETRRKARLETARPERP |
Ga0134065_102213702 | 3300010326 | Grasslands Soil | MHLHLVRVAEQAKPLPRPAKVVQLEARRQARREAALRERSRPRPAA* |
Ga0134065_102362064 | 3300010326 | Grasslands Soil | MHKHFVRVAARPKQAPRPAKIVQLEVRRKARLESARLQRQPPRPAA* |
Ga0134111_105315311 | 3300010329 | Grasslands Soil | MHLHLVRVAARPKQAPRPAKVVQFEVRRKARLESSQLQRQPPRPAA* |
Ga0134063_104684212 | 3300010335 | Grasslands Soil | MQRHLYLVVARPTPPPRPAKVVQLDVRREARLEQARRERSRPRPAA* |
Ga0134071_102480595 | 3300010336 | Grasslands Soil | AARPKQLPRPAKVIVLETRRKARLEAARPPRQPPHRPAA* |
Ga0134062_103768232 | 3300010337 | Grasslands Soil | MLLHLVRVAARPKPLIRPAKVVQLEVRRQARLEAARRERQRPRPAA* |
Ga0126376_129116872 | 3300010359 | Tropical Forest Soil | MHLHFVRVAKRPQTVRRPAKVVVLETRRKARLERSRPQPRSAA* |
Ga0126377_102918133 | 3300010362 | Tropical Forest Soil | MHLHLVRLATLPTKEGRRPAKVVQLEARRQARLERQRPERPDQPDRRPAA* |
Ga0126377_133955992 | 3300010362 | Tropical Forest Soil | MHLHLVRVAARPKPVQRPAKVVQLDVRREARLEAERLQAQRPRPAA* |
Ga0134125_130670751 | 3300010371 | Terrestrial Soil | MYLRLVRVAVQPEQHPQVQRPAKVVQLEARRKAREAQRAQWQPPRAAA* |
Ga0105239_100030004 | 3300010375 | Corn Rhizosphere | MHRHLHIVRLAPPRPVRPERPAKVIVLDVRRKARLEAARPERQPPRDAA* |
Ga0105239_109066511 | 3300010375 | Corn Rhizosphere | RGVSEMHLHLVRVASRPKQAQRPAKVVQLETRRQARLERQRLERHRPRPAA* |
Ga0126383_123616301 | 3300010398 | Tropical Forest Soil | MHLHLVRVAARPEPVQRPAKVVQLDVRRKARLEAERLEAQRPRPA |
Ga0134127_103174112 | 3300010399 | Terrestrial Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWERPRPAV* |
Ga0134123_104085361 | 3300010403 | Terrestrial Soil | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARLEAARRESERPRPAA* |
Ga0126354_11623571 | 3300010857 | Boreal Forest Soil | MYRRLVRVEVSERALRPARVIALEARRRARLEAARPKRQPPRHA |
Ga0137391_107057351 | 3300011270 | Vadose Zone Soil | MHLHLVRVAARPKAPRPAKVVSLEVRRQARLEAARPKRPAPRPAA* |
Ga0120139_10438622 | 3300012019 | Permafrost | MHLHLVRVAARPKRVPRPAKVIALEARRKARLEAARPERQPPRPAA* |
Ga0136621_10003885 | 3300012092 | Polar Desert Sand | MHLHLVRLAARPKQAPRPAKVVVLETRRKARLEAARPERQPPRPAA* |
Ga0136632_102186051 | 3300012093 | Polar Desert Sand | MHLRPLTGAPRGAPRQRGGEMHLHLVRVAARPERPLPAKVVVLETRRKARLEAARPERQPPRPAA* |
Ga0136620_101317131 | 3300012186 | Polar Desert Sand | RGAPRQRGGEMHLHLIRVAARPERPLPAKVVVLETRRKARLEAARPERQPPRPAA* |
Ga0136620_102451831 | 3300012186 | Polar Desert Sand | MHLHLVRVAARPKQAPRPAKVVVLEARRKARLEAARPERQP |
Ga0136618_102060221 | 3300012188 | Polar Desert Sand | MHLHLVRVAARPERPLPAKVVVLETRRKARLEAARPERQPPRPAA* |
Ga0137364_107257102 | 3300012198 | Vadose Zone Soil | MHLHLVRVAARPKPVLPRPSKVVQLEARRKARLEAALPQRPRPRPAA* |
Ga0137364_113129212 | 3300012198 | Vadose Zone Soil | MHLHLVRVAARPKQAPRPAKVVQLEVRREARLEAARRAARRPRPAA* |
Ga0137399_107885902 | 3300012203 | Vadose Zone Soil | MHLHLVRVAARPKPVPRPAKVVQLEVRRKARLERARSQRPPSRPA |
Ga0137399_108990243 | 3300012203 | Vadose Zone Soil | MHLHLVRVAARPKPVPRPAKVIALDARREARLETARPERQPTRP |
Ga0137374_1000112050 | 3300012204 | Vadose Zone Soil | MHLHLVRVAARPKPVPRPAKVVQLEARRKARLDAARPQRQPPRPAA* |
Ga0137374_100270629 | 3300012204 | Vadose Zone Soil | MHLHLVRVAARPKPVLRPAKVVQLEVRRKARLQAARPKRQPPRTAA* |
Ga0137374_101206783 | 3300012204 | Vadose Zone Soil | MHLHLVRVAARPKQVPRPAKVVQLEARRQARLEAARPERQPPPRRAA* |
Ga0137374_104548022 | 3300012204 | Vadose Zone Soil | MHLHLVRVAARPKPVPRPSKVVQLEARRKARLEAARRERPRPRPLA* |
Ga0137374_105031693 | 3300012204 | Vadose Zone Soil | MHLHLVRVAARTKQVPRPAKVVQLDVRRKARLEPARPERPRPRPAA* |
Ga0137374_112345712 | 3300012204 | Vadose Zone Soil | MHRHLVLVVARPQRLPRPAKVVLLDARRKARLEAARADRQRPRPAA* |
Ga0137377_100515357 | 3300012211 | Vadose Zone Soil | MHLHLVRVAARPKQVPRPAKVIALDARRKARLEAARPERQPPRPAA* |
Ga0137377_110293094 | 3300012211 | Vadose Zone Soil | SREESEMHLHLVRVAARPKQVPRPAKVIALDARRKARLDAARPERQPPRHAA* |
Ga0137377_110736696 | 3300012211 | Vadose Zone Soil | MHLHLVRVAARPKPMPRPAKVVQLEVRRKARLERARSQRPP |
Ga0150985_1198952042 | 3300012212 | Avena Fatua Rhizosphere | MHLHLVQVAARPKQALRPARPARVVQLEARRKARLAAARPERQPPRAAA* |
Ga0137372_101185363 | 3300012350 | Vadose Zone Soil | MRLRLVRIVARPKPVPRPAKVIVLESRRKARLEAARPSRPAA* |
Ga0137372_102458352 | 3300012350 | Vadose Zone Soil | MHLHLVRVAARPKPVPRPAKVVQLEARRKALEAVRPERQPPRTAA* |
Ga0137372_111043042 | 3300012350 | Vadose Zone Soil | MHLHLVRVAARPKQLPRPAKVIVLETRRKARLEAARPRRQPPHRPAA* |
Ga0137366_105360222 | 3300012354 | Vadose Zone Soil | MHLHLVRLAARPKQAPRPAKVVQLDVRRKARLEAARPEPERQPPRPAA* |
Ga0137369_100403437 | 3300012355 | Vadose Zone Soil | MHLRLVRVAARPQRPRPAKVVVLATRRKARLEAARPKRQPPRPAA* |
Ga0137369_100856302 | 3300012355 | Vadose Zone Soil | MHLHLVPVAARPKPAPRPAKVVVLEARRKARLEAARPEREPPRSAA* |
Ga0137371_112350022 | 3300012356 | Vadose Zone Soil | MHLHLVRVAARPKQVPRPAKVVQLEARRKARLEAARHKRQPPQAAA* |
Ga0137384_115811581 | 3300012357 | Vadose Zone Soil | MHLHLVRVAARPKRPLRPAKVVMLEVRRKARLDAARHERQPTRPAA* |
Ga0137368_100609363 | 3300012358 | Vadose Zone Soil | MHLHLVRVAARPKPAPRPAKVVVLEARRKARLEAARPEREPPRSAA* |
Ga0137385_113689752 | 3300012359 | Vadose Zone Soil | MHLHLVRFAARPKQAPRPAKVVQLEARRKARLDAARPKRQPPRPAA* |
Ga0137361_1025967913 | 3300012362 | Vadose Zone Soil | MHLHLVRLAARPKQVPRPAKVVQLDVRREARFEAARPDRSRPRPAA* |
Ga0150984_1236029662 | 3300012469 | Avena Fatua Rhizosphere | MHLHLVRVVARPKAVQRPAKVIVLETRRQARLERLDPKRQPPRPAA* |
Ga0157345_10298574 | 3300012498 | Arabidopsis Rhizosphere | RLVPPRPVRAERPAKVIVLDVRRKARLEAARPERQPPRDAA* |
Ga0157304_10590082 | 3300012882 | Soil | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARREWERPRPAA* |
Ga0157287_10753292 | 3300012885 | Soil | MHRHLHIVRLVPPRPVRPERPAKVIVLDVRRKARLEAARPERQPPRHAA* |
Ga0157287_11027481 | 3300012885 | Soil | MHRHLHIVRLVPPRPVRPERPAKVIVLDARRKARLE |
Ga0157305_100561333 | 3300012891 | Soil | LHIVRVAARPRPQPRPAPRPAKVIILEARRQARLEAARREWQRPRPAA* |
Ga0157303_100698232 | 3300012896 | Soil | MHLHIVRVAARPRFAPRSAPRPAKVIVLEARRQARIEAARREWERPRPAV* |
Ga0157285_100042876 | 3300012897 | Soil | CRRDYLHDVRGGAVMHRHLHIVRLVPPRPVRPERPAKVIVLDVRRKARLEAARPERQPPRDAA* |
Ga0157285_101778881 | 3300012897 | Soil | SDMHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWERPRPAA* |
Ga0157288_102253401 | 3300012901 | Soil | RNYLHDVRGGAVMHRHLHIVRLVPPRPVRPERPAKVIVLEARRKARLEAARPERQPPRDAA* |
Ga0157288_104236862 | 3300012901 | Soil | MHLHLVRVVARPQPLPRPAKVIVLETRRKARLEAARPKRQPPRPAA* |
Ga0157283_100942131 | 3300012907 | Soil | SQRGDEMNLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPTRPAA* |
Ga0157283_101191681 | 3300012907 | Soil | LHIVRLVPPRPVRAERPAKVIVLEVRRKAPLEAARPERQPPRDAA* |
Ga0157290_102555602 | 3300012909 | Soil | MHLHLVRVTARPKQPLRPAKVVVLETRRKARLDTVAPQPPAPRPAA* |
Ga0157297_102827081 | 3300012914 | Soil | MHRHLHIVRLVPPRPVRPERPAKVIVLDARRKARLEAARPERQPPRHAA* |
Ga0137407_118467951 | 3300012930 | Vadose Zone Soil | MHLHLVRLAARPKQVPRPAKVVHLDVRREARFEAARPDRSRPRPAA* |
Ga0164241_100238936 | 3300012943 | Soil | MHRHRHIVRLVPPRPVRPERPAKVIVLEARRKARLEAQRPERQPPRDAA* |
Ga0164241_104780072 | 3300012943 | Soil | MHQHLHPHVVRLVRPRPMRPHRPALVIDLEARRQARLEAQRPERQPPRDAA* |
Ga0137410_102244366 | 3300012944 | Vadose Zone Soil | AARPKQVPRPAKVIALDARRKAPLEAARPERQPPRPAA* |
Ga0164300_108995901 | 3300012951 | Soil | MHLHLVRVAARPAQAVVRPAKVVALDSRRNARLEAARLRERQRPRPAA* |
Ga0164300_110848213 | 3300012951 | Soil | MQRHLVRVAARPAQVARPAKVIVLETRRKARLEASRPQPRQPRPAA* |
Ga0164303_108098963 | 3300012957 | Soil | MHLHLVRVAARPRPVPRPAKVIALDARREARLETARPERQPTRPAA* |
Ga0164302_100273471 | 3300012961 | Soil | MHRHLHVVRLVPPRPVRAGRPAKVIVLAVRREARLEAARPERQPPRDAA* |
Ga0164302_101088832 | 3300012961 | Soil | MHLHLVRVAARPAQAVCRPAKVVALDSRRNARLEAARLRERQRPRPAA* |
Ga0164302_116477562 | 3300012961 | Soil | MHLHLVRVATRPTLAVARPAKVIVLDSRRKARIEAARLRERQRPRPAA* |
Ga0134110_102313884 | 3300012975 | Grasslands Soil | VRVAARPKPVPRSAKVVQLEARRKARLDAAQPQRQPPRPAA* |
Ga0134076_102844731 | 3300012976 | Grasslands Soil | MHLHLVRVAARPKQAPRPAKVVQLEVRRKARLEAARRERQRPR |
Ga0164308_112873121 | 3300012985 | Soil | MHLHLVRVATRPTQAVARSAKVVALDSRRKARLEAARQRERQRPRPAA* |
Ga0164307_103550111 | 3300012987 | Soil | MHLHLVRVATRPTLAVARPAKVIVLDSRRKARIEAARQRERQRPRPAA* |
Ga0163162_102091922 | 3300013306 | Switchgrass Rhizosphere | MHLHLVRVVTRPTQAVARPAKVVALESRRKARLEADRLRERQRPRPAA* |
Ga0134079_101987142 | 3300014166 | Grasslands Soil | MHLHLVRVVARPKAPRPAKVVSLEARRKARLEVARPRRPRPAA* |
Ga0163163_113471344 | 3300014325 | Switchgrass Rhizosphere | HVVRVAARPKALPRPAKVVVLEARRKARLEKSRPAPFPPAA* |
Ga0157380_107452284 | 3300014326 | Switchgrass Rhizosphere | MHLHIVRVAARPGLEPRPAPRPAKVIVLEARRQARIEAARLERQHPRPAA* |
Ga0157380_123885494 | 3300014326 | Switchgrass Rhizosphere | REMHRHLHVVRLVPPRPVRAERPAKVILLDVRRKARLEAARPERQPPRDAA* |
Ga0182008_101276843 | 3300014497 | Rhizosphere | MHRHLHIVRLVPPRPVRPERPAKVIVLEARRKARLEAARPERQPPRHAA* |
Ga0157377_100536621 | 3300014745 | Miscanthus Rhizosphere | TREESDMHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLEQQHPRPAA* |
Ga0157379_111544992 | 3300014968 | Switchgrass Rhizosphere | MHLHLVRVVARPKDVPRPAKVVQLEARREARLQPRRSNWQPPRPAA* |
Ga0157376_108220252 | 3300014969 | Miscanthus Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLERQRPRPAA* |
Ga0173480_108239591 | 3300015200 | Soil | MHLHLVRVATRPTQAVARPAKVVALDSRRKARLEAA |
Ga0173478_102887661 | 3300015201 | Soil | MHRHLHIVRLVPPRPVRPERPAKVIVLDVRRKARL |
Ga0137409_104725871 | 3300015245 | Vadose Zone Soil | HLHLVRLAARPNPVPRPAKVVQLDARREARFEAARPDRSRPRPAA* |
Ga0182005_11750002 | 3300015265 | Rhizosphere | MHLHLVRVAARPKQVPRPAKVVQLEARRKARLEAARPERPQPRPAA* |
Ga0134072_100894651 | 3300015357 | Grasslands Soil | MHLHLVRVAAPPKHVQRPAKVVVLETRRKARLEAARREPR |
Ga0134089_104123132 | 3300015358 | Grasslands Soil | MHLHLVRVAARPKPVPRPAKVVQLESRRKARLDAARPQRQPPRPAA* |
Ga0134089_105720613 | 3300015358 | Grasslands Soil | MHLHLVRVAARPKRPPRPAKVVVLEARRRARLELARPERQPPRPAA* |
Ga0132258_101814589 | 3300015371 | Arabidopsis Rhizosphere | MHLHLVPVAARPKPMLRPAKVVQLDVRREARLEAARAERQPPRPAA* |
Ga0132258_107522141 | 3300015371 | Arabidopsis Rhizosphere | MHLHIVRVAARPGLEPRPAPRPAKVIVLEARRQARIEAARLEQQHPRPAA* |
Ga0132258_121089502 | 3300015371 | Arabidopsis Rhizosphere | MHRHLHIVRLVPPRPVRADRAAKVIVLDVRRKARLEAARPERQPPRDAA* |
Ga0132258_123144042 | 3300015371 | Arabidopsis Rhizosphere | MHLHLVRVAARPKPKPEQRPAKVVQLDVRRKARLEAERLEAQRPRPAA* |
Ga0132258_130071021 | 3300015371 | Arabidopsis Rhizosphere | MHLQLVREAARPKPLPRPAKVVLLETRRQARLERARPEAERYPARPAA* |
Ga0132257_1012801292 | 3300015373 | Arabidopsis Rhizosphere | DRKEREMHQHLHPHIVRLVRPRAVRPQRPAKVIALDARRKARLEAQRSERQAPPDAA* |
Ga0132255_1003230265 | 3300015374 | Arabidopsis Rhizosphere | MHLHIVRVAARPRPAPRPAKVIVLEARRQARIEAAQLERHRPRPAA* |
Ga0132255_1016350433 | 3300015374 | Arabidopsis Rhizosphere | MHQHLHPHIVRLVRPRPVRPQRPAKVIALDARRKARLEAQRSERQP |
Ga0132255_1036725491 | 3300015374 | Arabidopsis Rhizosphere | QRGAEMHLHLVRVAARPVAHRPAKVVQLEARRKARLEALRPWPGPAA* |
Ga0132255_1046876172 | 3300015374 | Arabidopsis Rhizosphere | MHLHLVRVATRPTQAVARPAKVVALDSRRKARLEAARLQRQPPRPAA* |
Ga0182040_108394772 | 3300016387 | Soil | MHLRLVQVDAAQPTPQPLPRPAKVVQLEARRQARLEAERLER |
Ga0134074_11174212 | 3300017657 | Grasslands Soil | MHKHFVRVAARPKQAPRPAKVVQFEVRRKARLESSQLQRQPPRPAA |
Ga0134083_103330502 | 3300017659 | Grasslands Soil | MHLHLVRVVARPQPPRPAKVVSLEARRQARLEALRPQRPPTRPAA |
Ga0183260_101367283 | 3300017787 | Polar Desert Sand | MHLHLVRLAARPKQAPRPAKVVVLETRRKARLEAARPERQPPRPAA |
Ga0136617_100292402 | 3300017789 | Polar Desert Sand | MHLHLVRVAARPERPLPAKVVVLETRRKARLEAARPERQPPRPAA |
Ga0136617_100705495 | 3300017789 | Polar Desert Sand | MHLHLVRVEARPERPLPAKVVVLETRRKARLEAARPERQPPRSAARPGAA |
Ga0163161_107153322 | 3300017792 | Switchgrass Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARLDAARLERQHPRPAA |
Ga0187786_100212925 | 3300017944 | Tropical Peatland | MLLHLVRVTPRPNTVPRPAKVVQLEVRRLARLEAARAERTRPRPAA |
Ga0187786_106079682 | 3300017944 | Tropical Peatland | MHLHLVRVAPRPKTVGPRPAKIVQLDVRRQARLEAARPERPETRPAA |
Ga0187779_102174325 | 3300017959 | Tropical Peatland | MHLRLVQVDAAQLKPVPRPAKVVQLEARRQARLEAERLERLRPRPAA |
Ga0190266_100182655 | 3300017965 | Soil | MNLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPTRPAA |
Ga0190266_101755703 | 3300017965 | Soil | MHLHLVRLTARPELPLRPAKVIVLETRRKAWLDTVKPERPAPRPAA |
Ga0187776_103254692 | 3300017966 | Tropical Peatland | MHLHLVRVAARPMVPAPAPTPRPAKVVQLEVRRQARLEAARLQRLPPRPAA |
Ga0187776_106796201 | 3300017966 | Tropical Peatland | MHLHLVRVAARPAQVPRPAKVVQLEVRRKARLEAARPQRQPPRPAA |
Ga0187776_107346932 | 3300017966 | Tropical Peatland | MRKQLIGLVRPRPQPPRPAKVVVLEARRRARLEAARPVPPIRPAA |
Ga0184610_12658692 | 3300017997 | Groundwater Sediment | MHLHLVRVTARPKEASRPAKLIVLETRRKARLEAAQPKRQPPRPAA |
Ga0184605_1016073110 | 3300018027 | Groundwater Sediment | MHLHLVRVAARPKPVPRPKVVRLEDRRKARLEAARRDRP |
Ga0187788_103395191 | 3300018032 | Tropical Peatland | MHLHLVRVAARPMVPVPAPKPRPAKVVQLEVRRQARLEAARLQRLPPRPAA |
Ga0184626_101473704 | 3300018053 | Groundwater Sediment | MHLHLVRIAARPKQAPRPAKVVVLETRRKARLEAARPERQPPRPAA |
Ga0184621_101581212 | 3300018054 | Groundwater Sediment | MHLHLVRVAARPKQVPRPAKVVQLDVRRKARLEAARPQRQPPRP |
Ga0184623_100787802 | 3300018056 | Groundwater Sediment | MHLHLVRVAARPKQAPRPAKVVVLETRRKARLEAARPERQPPRPAA |
Ga0187766_100969392 | 3300018058 | Tropical Peatland | MHLRLVQVDAAQLKPVPRPAKVVQLEARRQARLEAERLQRTRPRPAA |
Ga0187765_100137572 | 3300018060 | Tropical Peatland | MHLRLVAVDVAQPKPQQRPAKVVQLEARRQARLEAERLQRTRPRPAA |
Ga0184637_102774554 | 3300018063 | Groundwater Sediment | MHLHLVRVAARPKQALRPAKVVVLETRRKARLEAARPERPGPRPAA |
Ga0187773_105437372 | 3300018064 | Tropical Peatland | MHLHLVRVAARPMVPVPAPKPRPAKVVQLEVRRQARLEAARLQPQHTRPAA |
Ga0187774_109754481 | 3300018089 | Tropical Peatland | EEVGEMHLHLVRVVPRPKTVGPRPAKVVQLDVRRQARLEAARPERPETRPAA |
Ga0190265_1000311512 | 3300018422 | Soil | MHLHLVRVAARPQKAPRPAKVVVLETRRKARLEAQRAERQPRPAA |
Ga0190265_100910746 | 3300018422 | Soil | MHLHLVRVAARPKQPLRPAKVVVLETRRQARLETTRPERQPPRPAA |
Ga0190265_104108655 | 3300018422 | Soil | MHLHLVRIAARPKQAPRPAKVVVLETRRKARLETARPERPGPRPAA |
Ga0190265_138337681 | 3300018422 | Soil | MHLHLVRVAARPKQAPRPAKVVVLETRRTARLEAARHERPTPRPAA |
Ga0190272_108202982 | 3300018429 | Soil | MHLHLVRVAARPKHVPRPAKVVVLETRRKARLEVARPERPSRQPAA |
Ga0190272_131429791 | 3300018429 | Soil | LVRVAARPKQPQRPAKVVVLESRRKARLEAARPERPPPRPAA |
Ga0190269_100731835 | 3300018465 | Soil | MHLHLVRVTARPKQPLRPAKVVVLETRRQARLETARPERQPPRPAA |
Ga0190269_114907692 | 3300018465 | Soil | MHLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPPRPA |
Ga0190268_100840383 | 3300018466 | Soil | MHLHLVRVAARPKQPQRPAKVVVLESRRQARLEAARSKRQPPRPAA |
Ga0190268_103162832 | 3300018466 | Soil | MHLHLVRVVARPTQAPRPAKVVVLATRRQARLEQARRERQMPRPAA |
Ga0190270_102438451 | 3300018469 | Soil | PEGAAPRPYRREENEMHLHLVRVVARPKQAPRPAKLVVLATRRQARLEQARRERQTPKPA |
Ga0190270_104773392 | 3300018469 | Soil | MHLHLVRVVARPAQAPRPAKVVVLATRRQARLEQARRERQTPRPAA |
Ga0190270_108803724 | 3300018469 | Soil | MNLHLVRVAARPKQAHRPAKVVVLESRRRARLEAARSKWQPPRPAA |
Ga0190270_128660122 | 3300018469 | Soil | MHLHLVRVTARPKQPLRPAKVVVLETRRKARLEAARPERQPPRPAA |
Ga0190274_128273342 | 3300018476 | Soil | MHLHLVRVAARPKQAPRPAKVVVLETRRKARLEAARPERPGPRPAA |
Ga0190271_100583333 | 3300018481 | Soil | MHLHLVRVVARPTQAPRPAKVVVLATRRQARLEQARRERQTPKPAA |
Ga0173481_100029073 | 3300019356 | Soil | MHRHLHIVRLVPPRPVRAERPAKAIVLEVRRKARLEAARPERQPPRDAA |
Ga0173481_100094752 | 3300019356 | Soil | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPERQPPRDAA |
Ga0173481_100172086 | 3300019356 | Soil | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARREWQRPRPAA |
Ga0173481_100341527 | 3300019356 | Soil | MHRHLHIVRLVPPRPVRPERPAKVIVLDVRRKARLEAARPERQPPRDAA |
Ga0190267_104014081 | 3300019767 | Soil | MNLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARS |
Ga0190267_108941482 | 3300019767 | Soil | MHLHLVRIAARPKQVPRPAKVVVLETRRKARLEAARPERPGPRPAA |
Ga0190267_109859143 | 3300019767 | Soil | IHRKESEMHLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPTRPAA |
Ga0206356_102218291 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRHLVRVAARPAQVARPAKVIVLETRRKARLEASRPQPREPRPAA |
Ga0206349_19258281 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLARVAAPPRRAPRPAKVIQLETRRQARLERARPERQPPRTA |
Ga0182009_102248641 | 3300021445 | Soil | MHLHLVRVAKLPKQLQRPAKVVQLEVRRQARAERALRERSHPRPAA |
Ga0182009_106241271 | 3300021445 | Soil | MHLHLVRVAARPAAHRPAKVVQLEARRKARLEARRPRPRPAA |
Ga0247747_10188833 | 3300022737 | Soil | MHRHLHIVRLVPPRPVRPERPAKVIVLEARRKARLEAARPERQPPRDAA |
Ga0247747_10489381 | 3300022737 | Soil | HLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARRECERPRPAA |
Ga0247786_11193241 | 3300022883 | Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARLERQHPRPAA |
Ga0247746_10359321 | 3300022886 | Soil | MHRHLHIVRLVPPRPVRAERPAKAIVLEVRRKARLEAARPERQPPRDA |
Ga0247785_10108562 | 3300022889 | Soil | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAERLERQHPRPAA |
Ga0247787_10039502 | 3300022893 | Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWERPRPA |
Ga0247787_10287601 | 3300022893 | Soil | HLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQSPRPAA |
Ga0247801_10255642 | 3300023064 | Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIE |
Ga0247793_10038772 | 3300023066 | Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQSPRPAA |
Ga0247799_10055467 | 3300023072 | Soil | NLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPTRPAA |
Ga0247800_10114312 | 3300023263 | Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWERPRPAA |
Ga0247794_100148522 | 3300024055 | Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARLEAARRESERPRPAA |
Ga0247794_100550183 | 3300024055 | Soil | MHRHLHIVRLVPPRPVRPERPAKVIVLDARRKARLEAARPERQPPRHAA |
Ga0247794_100885932 | 3300024055 | Soil | MHLHLVRVVTRPTQAVARPAKVVALDSRRKARLEAARQRERQRPRPAA |
Ga0207697_105316442 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARLERQHPRPA |
Ga0207692_106907772 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRHLMLVTARPKETLRPAKVIVLESRRKARLETA |
Ga0207642_104295712 | 3300025899 | Miscanthus Rhizosphere | MHLHLVRVVTRPTQAVARPAKVVALDSRRKARLEADRLRERQRPRPAA |
Ga0207688_100458621 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLEQQHPRPAA |
Ga0207688_111025971 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRVVTRPAQAVARPAKVVALESRRKARLEADRLRERQRPRPAA |
Ga0207680_111354211 | 3300025903 | Switchgrass Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPERQP |
Ga0207699_103829363 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRHLMLVTARPKETLRPAKVIVLESRRKARLETAWHERHRPRPAA |
Ga0207643_100534081 | 3300025908 | Miscanthus Rhizosphere | MQLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPPRPA |
Ga0207643_100544336 | 3300025908 | Miscanthus Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLERQHPRPAA |
Ga0207643_102216922 | 3300025908 | Miscanthus Rhizosphere | MHRHLHIVRLVPPRPVRPEKVIVLDARRKARLEAARPERQPPRHAA |
Ga0207684_102532821 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DREEAEMHLHLVRLAARPKPVPRPAKVVQLDARREARLEAARRERSRPRPAA |
Ga0207684_115906162 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLHLVRIAARPKPAPRPAKVVVLETRRKARLEAARPERQPAA |
Ga0207695_113572802 | 3300025913 | Corn Rhizosphere | MHRHLHIVRLVPPRPVRPERPAKVIVLEARRKARLEAARPERQPPRPAA |
Ga0207662_101924002 | 3300025918 | Switchgrass Rhizosphere | MHLHLVRVVTRPTQAVARPAKVVALESRRKARLEADRLRERQRPRPAA |
Ga0207662_111939832 | 3300025918 | Switchgrass Rhizosphere | MHRHLMLVVARPNPAPRPAKVVLLEPRRKARLEKSRPLPQPPRAA |
Ga0207650_100099667 | 3300025925 | Switchgrass Rhizosphere | MHLHIVRVAARPLPQPRPAPRPAKVIVLEARRQARLEAARPERQRPRPAA |
Ga0207650_118665871 | 3300025925 | Switchgrass Rhizosphere | MHLHLVRVASRPKQAQRPAKVVQLETRRQARLERQRLERHR |
Ga0207687_100669445 | 3300025927 | Miscanthus Rhizosphere | MHRHLHIVRLVPPRPVRAERPAKVIVLEVRRKARLEAARPERQPPRDAA |
Ga0207687_104972403 | 3300025927 | Miscanthus Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVILLDVRRKARLEAARPERQPPRDAA |
Ga0207687_111419492 | 3300025927 | Miscanthus Rhizosphere | MHLHLVRLAARPNDVPRPAKVVQLEARREARLQPRRSKW |
Ga0207700_102729506 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PRAPFQREEQEMHLHLVRVAKQPVELQRQAKVVQLEARRQARLEAALRERSRPRPAA |
Ga0207669_105976763 | 3300025937 | Miscanthus Rhizosphere | HVVRLVPPRPVRAERPAKVILLDVRRKARLEAARPERQPPRDAA |
Ga0207704_102846582 | 3300025938 | Miscanthus Rhizosphere | MHLHIVRVAARPGLEPRPAPRPAKVIVLEARRQARIEAERLERQHPRPAA |
Ga0207679_109377391 | 3300025945 | Corn Rhizosphere | YAREESDMHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLEQQHPRPAA |
Ga0207679_113575352 | 3300025945 | Corn Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARI |
Ga0207667_101025874 | 3300025949 | Corn Rhizosphere | MHLHLARVAAPPRRAPRPAKVIQLETRRQARLERARPERQPPRTAA |
Ga0207658_116375783 | 3300025986 | Switchgrass Rhizosphere | MHRHLHIVRLVPPRPVRPERPAKVIVLEARRKARL |
Ga0207677_106635711 | 3300026023 | Miscanthus Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARLDAARLERQHPR |
Ga0207639_100576703 | 3300026041 | Corn Rhizosphere | MHRHLHIVRLVPPRPVRPERPAKVIVLEARRKARLEAARPERA |
Ga0207708_1000165731 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPERQPPRDAV |
Ga0207702_102633172 | 3300026078 | Corn Rhizosphere | MHLHLVRIAARPKQVPRPAKVVQLDVRREARLEAARPRRQPPKPAA |
Ga0207648_105305703 | 3300026089 | Miscanthus Rhizosphere | MQLHLVRVAARPKQPQRPAKVVVLESRRQARLDVARSKRQPTRPAA |
Ga0207676_100688433 | 3300026095 | Switchgrass Rhizosphere | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPDRQPPRDAA |
Ga0207676_103564344 | 3300026095 | Switchgrass Rhizosphere | MHLHIVRVAARPRLEPRPAPRPAKVIVLEARRQARIEAARLERQRPRPAA |
Ga0209473_13156052 | 3300026330 | Soil | MHLHVVRVAARPKQPLRPAKVVVLDVRRKARLEASRPERQPPRPAA |
Ga0209804_12697392 | 3300026335 | Soil | MHLHLVRVAARPKYVPRPAKVVQLEVRRKARLEAARPERLAPRPAA |
Ga0209474_102203173 | 3300026550 | Soil | MHLHLVRVAARPKQPLRPAKVVVLESRRKARLEASQPERPRPRPAA |
Ga0209474_104021841 | 3300026550 | Soil | RDREEAEMHLHLVRVAARPKQVPPRPAKVVQLDVRREARLETARRDTQQPRPAA |
Ga0209474_107076282 | 3300026550 | Soil | MHFHLVRVAARPKPVPRPAKVVQLEVRRKTRLETARPQRPPPR |
Ga0209485_11783642 | 3300027691 | Agricultural Soil | MHLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPPRPAA |
Ga0209461_101566171 | 3300027750 | Agave | LVRVAARPKRPFRPAKVVVLETRRKARLEAARPERQPPRPAA |
Ga0209811_102226993 | 3300027821 | Surface Soil | MHRHLTVVVARPKETQRPAKVIVLESRRKARLETAWHERHRPRPAA |
Ga0209382_113503542 | 3300027909 | Populus Rhizosphere | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQRPRPAA |
Ga0265319_12330582 | 3300028563 | Rhizosphere | TRRKEDEMHLHLVRVAAPRKEAQRPAKVVALESRRQARLEAQRPQRLPNKPAA |
Ga0265318_101896462 | 3300028577 | Rhizosphere | MHLHLAHVAARPKQRPAKVVQLEVRREARLEQAKQRPPWRPAA |
Ga0247828_107816703 | 3300028587 | Soil | MHLHLVRLTARPEPPLRPAKVIVLETRRKERLDTVKPERPAPRPAA |
Ga0247818_103951113 | 3300028589 | Soil | MHLHLVRVTARPKQPQRPAKVVVLETRRKARLEAARPERQPPRPAA |
Ga0247821_100892553 | 3300028596 | Soil | MHRHLHVVRLVPPRPVRAERPAKVIVLEVRRKARLEAARPERQPPRDAA |
Ga0307282_100173742 | 3300028784 | Soil | MHLHLVRVAARPKQAPRPAKVIVLETRRKARLEAARPMRQPPRPAA |
Ga0307290_100339681 | 3300028791 | Soil | GGEMHLHLVRVAVRPKPVPRPKVVRLEDRRKARLEAARRDRPRPPRPAA |
Ga0307305_100031338 | 3300028807 | Soil | MHLHLVRVAARAKPAPRPAKVVHLEARRKARLEAARRDRPRPRPIA |
Ga0307305_104477121 | 3300028807 | Soil | MHLHLVRVAARPKQVPRPAKVIALDARRKARLEAARPERQPPRPA |
Ga0307302_102647535 | 3300028814 | Soil | MHPNLVRVAAHPKQAPRPAKVVQLEARRKARLEAARPKRPPPRQAA |
Ga0307296_100249903 | 3300028819 | Soil | MHLHLVRVAARAKPAPRPAKVVHLEARRKARLEAARRDRPRPRPAA |
Ga0307310_101149702 | 3300028824 | Soil | MHLHLVRVAARPKPAPRPAKVVVLEARRKARLEAARP |
Ga0307310_105654042 | 3300028824 | Soil | MTQKGGEMHLHLVRVAVRPKPVPRPKVVRLEDRRKARLEAARRDRPRPPRPAA |
Ga0307308_100383862 | 3300028884 | Soil | MHLHLVRVAARPKQVPRPAKVIALDARRKARLEAARPERQPPRLAA |
Ga0247827_103009002 | 3300028889 | Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARLEAARREWQRPRPAA |
Ga0247827_109048081 | 3300028889 | Soil | MHLHLVRLTARPELPLRPAKVIVLETRRKARLDTVKPERPAPRPAA |
Ga0307497_104255502 | 3300031226 | Soil | MHLHLVRVVARPKDVSRPAKVVQLEARREARLQPRRFKWQPPRPAA |
Ga0307506_100972462 | 3300031366 | Soil | MHLHLVRVVARPKDVPRPAKVVQLEARREARLQPRRFKWQPPRPAA |
Ga0318538_101756574 | 3300031546 | Soil | MHLRLVQVDAAQPTPQPLPRPAKVVQLEARRQARLEAERLERLRPRPAA |
Ga0247727_1000720723 | 3300031576 | Biofilm | MHRHLHLVRVAVHPKRTQRPAKVVQLEARRKARLEAVRPERQAPRPAA |
Ga0247727_102607055 | 3300031576 | Biofilm | GGRRAASTTTGRRGKMHLHLVRVAVGPKQVPRPAKIVQLEVRRKARLEAARPKRQPPRPA |
Ga0247727_104923471 | 3300031576 | Biofilm | MHRHLHLVRVAVHPKRTQRPAKVVQLEARRKARLEAAQPKRQPPRPAA |
Ga0306917_110607971 | 3300031719 | Soil | MHLHLVRVAARPKPEPVQRSAKVVQLDVRRKARLEAERLEAQRPRPAA |
Ga0318494_105681182 | 3300031751 | Soil | MHLRLVQVDAAQPTPQPLPRPAKVVQLEARRQARLEAERLE |
Ga0318546_110381772 | 3300031771 | Soil | MHLHLVRVAARPKPEPVQRSAKVVQLDVRRKARLEAARPAQPRPRPAA |
Ga0318547_110281941 | 3300031781 | Soil | DREEREMHLRLVQVDAAQPTPQPLPRPAKVVQLEARRQARLEAERLERLRPRPAA |
Ga0318512_106730423 | 3300031846 | Soil | REEHAMHLHLVRVAARPKQVPRPAKVVQLDVRRKARLEAARPERPRPRPAA |
Ga0310907_104886542 | 3300031847 | Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLDARRQAR |
Ga0307407_114004591 | 3300031903 | Rhizosphere | RVVARPAQAPRPAKVVVLATRRQARLEQARRERQTPRPAA |
Ga0308174_100374171 | 3300031939 | Soil | MHLHLVRVAAPPRRAPRPAKVIQLETRRQARLERTRPER |
Ga0310912_107658071 | 3300031941 | Soil | ERREEMHLHLVRVAARPKPQPRPAKVVELEVRRKARLEAERLEAQRPRPAA |
Ga0326597_117619643 | 3300031965 | Soil | PLAGLLQSQRGDDMQLHLVRVAARSKQPQRPAKVVVLETRRKARLEAARPERPRPRPAA |
Ga0308176_100260264 | 3300031996 | Soil | MHLHLVRVAAPPRRAPRPAKVIQLETRRQARLERARPERQPPRTAA |
Ga0307416_1014326032 | 3300032002 | Rhizosphere | MHLHLVRVVARPKEAPRPAKVVVLATRRQARLEQARRERQTPRPAA |
Ga0310906_102254981 | 3300032013 | Soil | LHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQRPRPAA |
Ga0310906_105197162 | 3300032013 | Soil | MHLHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQ |
Ga0310906_106146501 | 3300032013 | Soil | LHIVRVAARPRFAPRPAPRPAKVIVLEARRQARIEAARREWQSPRPAA |
Ga0310906_107043071 | 3300032013 | Soil | DEMNLHLVRVAARPKQPQRPAKVVVLESRRQARLDAARSKRQPTRPAA |
Ga0306924_119916944 | 3300032076 | Soil | EMHLRLEQVDAAQPTPQPLPRPAKVVQLEARRQARLEAERLERLRPRPAA |
Ga0268251_1000004380 | 3300032159 | Agave | MHLHLVRVAARPKRPFRPAKVVVLETRRKARLEAARPERQPPRPAA |
Ga0335085_100211548 | 3300032770 | Soil | MHLHLVRVAARPKPVVHPKVVRLEDRRKARLETAPRDRPRPRPAA |
Ga0335082_103024012 | 3300032782 | Soil | MRLYLVPAPARPKEAPRPAKVIVLEVRRQARLEASRPERQPPRQAA |
Ga0335080_1000009843 | 3300032828 | Soil | MHLHLVRVAARPMVPAPAPTPRPAKVVQLEARRQARLEAARLQRLPPRPAA |
Ga0335070_100763104 | 3300032829 | Soil | MHLHLVRVAARPMVPVPAPQPRPAKVVQLEVRRQARLEAARLQRLPPRPAA |
Ga0335070_102492865 | 3300032829 | Soil | MHHHLVRVAARPMVPVPAPTPRPAKVVQLEVRHQARLEAARLQRLPPRPAA |
Ga0335081_101377364 | 3300032892 | Soil | MHLHLVRVVPHPRPKVVGPRPAKIVQLEVRRQARLEAARPDRPGPRPAA |
Ga0335069_100531971 | 3300032893 | Soil | EEAEMHLHLVRVVPRPALVTVPRPAKVVQLEVRRQARLEAARADRTRPHPAA |
Ga0335069_118256262 | 3300032893 | Soil | MHLRLVAVDVAQPKPQQRPAKVVQLEARRQARLEAERLERT |
Ga0335076_100741486 | 3300032955 | Soil | MHLHLVRVAARPAVPARAPMPRPAKVVQLEARRLARLEAARLQRLPPRPAA |
Ga0335084_119981012 | 3300033004 | Soil | MHLRLVQVDAAQPKALPRPAKVVQLEARRQARLEAERLERLRPRPAA |
Ga0310810_104799373 | 3300033412 | Soil | AVMHRHLHIVRLVPPRPVRPERPAKVIVLDARRKARLEAARPERQPPRHAA |
Ga0310811_112515521 | 3300033475 | Soil | NARGGAVMHRHLHIVRLVPPRPVRPERPAKVIVLDARRKARLEAARPERQPPRHAA |
Ga0247829_101818681 | 3300033550 | Soil | MHLHLVRVATRPTQAVARPAKVVALDSRRKARLEAARLRERQRPRPAA |
Ga0370501_0012972_1064_1237 | 3300034195 | Untreated Peat Soil | MRAPFTEHREEQTMHLHFVRDAARPQPRPAKVVQLDVRRQARLEEKARPRPLFRPAA |
Ga0314781_035520_9_158 | 3300034660 | Soil | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPERQPPLDAA |
Ga0314782_031778_836_967 | 3300034661 | Soil | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPDRQP |
Ga0314796_079068_560_679 | 3300034671 | Soil | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARP |
Ga0314799_025154_1_138 | 3300034674 | Soil | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPERQPPR |
Ga0314803_055042_2_136 | 3300034678 | Soil | MHRHLHVVRLVPPRPVRAERPAKVIVLDVRRKARLEAARPERQPP |
⦗Top⦘ |