Basic Information | |
---|---|
Family ID | F004346 |
Family Type | Metagenome |
Number of Sequences | 442 |
Average Sequence Length | 46 residues |
Representative Sequence | MTNVCFAEAIKLGHGNGDRLGNQGGHAPTMEIVSVFKGWTTRLRM |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 442 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 7.69 % |
% of genes near scaffold ends (potentially truncated) | 75.57 % |
% of genes from short scaffolds (< 2000 bps) | 99.55 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (86.425 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (92.760 % of family members) |
Environment Ontology (ENVO) | Unclassified (93.439 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (93.213 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.99% β-sheet: 0.00% Coil/Unstructured: 63.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 442 Family Scaffolds |
---|---|---|
PF00665 | rve | 0.45 |
PF13966 | zf-RVT | 0.45 |
PF10551 | MULE | 0.23 |
PF00248 | Aldo_ket_red | 0.23 |
PF04195 | Transposase_28 | 0.23 |
PF14223 | Retrotran_gag_2 | 0.23 |
PF13952 | DUF4216 | 0.23 |
PF07714 | PK_Tyr_Ser-Thr | 0.23 |
PF00078 | RVT_1 | 0.23 |
PF14703 | PHM7_cyt | 0.23 |
COG ID | Name | Functional Category | % Frequency in 442 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 0.90 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.45 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.45 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.45 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 86.43 % |
All Organisms | root | All Organisms | 13.57 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005328|Ga0070676_11182640 | Not Available | 581 | Open in IMG/M |
3300005334|Ga0068869_102011650 | Not Available | 518 | Open in IMG/M |
3300005338|Ga0068868_101498402 | Not Available | 631 | Open in IMG/M |
3300005354|Ga0070675_101985011 | Not Available | 536 | Open in IMG/M |
3300005364|Ga0070673_100972027 | Not Available | 790 | Open in IMG/M |
3300005456|Ga0070678_100766903 | Not Available | 873 | Open in IMG/M |
3300005456|Ga0070678_101423459 | Not Available | 648 | Open in IMG/M |
3300005459|Ga0068867_101515727 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria | 625 | Open in IMG/M |
3300005459|Ga0068867_101563832 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 615 | Open in IMG/M |
3300005543|Ga0070672_101031732 | Not Available | 729 | Open in IMG/M |
3300005718|Ga0068866_11048958 | Not Available | 581 | Open in IMG/M |
3300005840|Ga0068870_10786907 | Not Available | 663 | Open in IMG/M |
3300005840|Ga0068870_11434744 | Not Available | 506 | Open in IMG/M |
3300006237|Ga0097621_100840278 | Not Available | 852 | Open in IMG/M |
3300006358|Ga0068871_101739908 | Not Available | 591 | Open in IMG/M |
3300006881|Ga0068865_100579874 | Not Available | 945 | Open in IMG/M |
3300006881|Ga0068865_101408313 | Not Available | 622 | Open in IMG/M |
3300009036|Ga0105244_10514087 | Not Available | 551 | Open in IMG/M |
3300009098|Ga0105245_12052106 | Not Available | 625 | Open in IMG/M |
3300009098|Ga0105245_12366737 | Not Available | 585 | Open in IMG/M |
3300009098|Ga0105245_13261572 | Not Available | 502 | Open in IMG/M |
3300009148|Ga0105243_12829306 | Not Available | 526 | Open in IMG/M |
3300009176|Ga0105242_12833241 | Not Available | 535 | Open in IMG/M |
3300011119|Ga0105246_11743665 | Not Available | 593 | Open in IMG/M |
3300013296|Ga0157374_11121054 | Not Available | 807 | Open in IMG/M |
3300013297|Ga0157378_12219810 | Not Available | 600 | Open in IMG/M |
3300013297|Ga0157378_13088157 | Not Available | 517 | Open in IMG/M |
3300014745|Ga0157377_11326305 | Not Available | 564 | Open in IMG/M |
3300014969|Ga0157376_11691371 | Not Available | 668 | Open in IMG/M |
3300015267|Ga0182122_1012332 | Not Available | 811 | Open in IMG/M |
3300015267|Ga0182122_1028556 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 652 | Open in IMG/M |
3300015267|Ga0182122_1043598 | Not Available | 581 | Open in IMG/M |
3300015267|Ga0182122_1047678 | Not Available | 567 | Open in IMG/M |
3300015267|Ga0182122_1055297 | Not Available | 543 | Open in IMG/M |
3300015267|Ga0182122_1067290 | Not Available | 513 | Open in IMG/M |
3300015268|Ga0182154_1017068 | Not Available | 748 | Open in IMG/M |
3300015268|Ga0182154_1026788 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 666 | Open in IMG/M |
3300015269|Ga0182113_1058729 | Not Available | 588 | Open in IMG/M |
3300015274|Ga0182188_1025402 | Not Available | 636 | Open in IMG/M |
3300015274|Ga0182188_1045133 | Not Available | 549 | Open in IMG/M |
3300015274|Ga0182188_1061268 | Not Available | 505 | Open in IMG/M |
3300015275|Ga0182172_1001523 | Not Available | 1482 | Open in IMG/M |
3300015275|Ga0182172_1053719 | Not Available | 560 | Open in IMG/M |
3300015276|Ga0182170_1008536 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 923 | Open in IMG/M |
3300015276|Ga0182170_1008940 | Not Available | 912 | Open in IMG/M |
3300015276|Ga0182170_1018893 | Not Available | 747 | Open in IMG/M |
3300015276|Ga0182170_1045110 | Not Available | 589 | Open in IMG/M |
3300015276|Ga0182170_1068986 | Not Available | 521 | Open in IMG/M |
3300015277|Ga0182128_1017566 | Not Available | 766 | Open in IMG/M |
3300015277|Ga0182128_1031370 | Not Available | 656 | Open in IMG/M |
3300015277|Ga0182128_1033351 | Not Available | 646 | Open in IMG/M |
3300015279|Ga0182174_1043293 | Not Available | 617 | Open in IMG/M |
3300015281|Ga0182160_1024339 | Not Available | 713 | Open in IMG/M |
3300015281|Ga0182160_1044788 | Not Available | 604 | Open in IMG/M |
3300015281|Ga0182160_1077740 | Not Available | 514 | Open in IMG/M |
3300015282|Ga0182124_1032220 | Not Available | 657 | Open in IMG/M |
3300015282|Ga0182124_1034791 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 644 | Open in IMG/M |
3300015282|Ga0182124_1055596 | Not Available | 565 | Open in IMG/M |
3300015282|Ga0182124_1066802 | Not Available | 535 | Open in IMG/M |
3300015283|Ga0182156_1023763 | Not Available | 733 | Open in IMG/M |
3300015283|Ga0182156_1042837 | Not Available | 622 | Open in IMG/M |
3300015283|Ga0182156_1059231 | Not Available | 567 | Open in IMG/M |
3300015283|Ga0182156_1064984 | Not Available | 551 | Open in IMG/M |
3300015283|Ga0182156_1073308 | Not Available | 531 | Open in IMG/M |
3300015285|Ga0182186_1022792 | Not Available | 730 | Open in IMG/M |
3300015285|Ga0182186_1024848 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 713 | Open in IMG/M |
3300015285|Ga0182186_1041202 | Not Available | 618 | Open in IMG/M |
3300015285|Ga0182186_1061214 | Not Available | 551 | Open in IMG/M |
3300015285|Ga0182186_1061327 | Not Available | 551 | Open in IMG/M |
3300015285|Ga0182186_1066009 | Not Available | 539 | Open in IMG/M |
3300015286|Ga0182176_1031861 | Not Available | 686 | Open in IMG/M |
3300015286|Ga0182176_1043385 | Not Available | 624 | Open in IMG/M |
3300015286|Ga0182176_1044034 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 621 | Open in IMG/M |
3300015286|Ga0182176_1051932 | Not Available | 590 | Open in IMG/M |
3300015286|Ga0182176_1054933 | Not Available | 579 | Open in IMG/M |
3300015287|Ga0182171_1030696 | Not Available | 683 | Open in IMG/M |
3300015287|Ga0182171_1031593 | Not Available | 677 | Open in IMG/M |
3300015287|Ga0182171_1056402 | Not Available | 576 | Open in IMG/M |
3300015287|Ga0182171_1059143 | Not Available | 568 | Open in IMG/M |
3300015287|Ga0182171_1071515 | Not Available | 537 | Open in IMG/M |
3300015288|Ga0182173_1011926 | Not Available | 871 | Open in IMG/M |
3300015288|Ga0182173_1013515 | Not Available | 842 | Open in IMG/M |
3300015288|Ga0182173_1013861 | Not Available | 836 | Open in IMG/M |
3300015288|Ga0182173_1028474 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 691 | Open in IMG/M |
3300015288|Ga0182173_1030384 | Not Available | 679 | Open in IMG/M |
3300015288|Ga0182173_1064746 | Not Available | 549 | Open in IMG/M |
3300015289|Ga0182138_1024261 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 729 | Open in IMG/M |
3300015289|Ga0182138_1044367 | Not Available | 618 | Open in IMG/M |
3300015289|Ga0182138_1065439 | Not Available | 552 | Open in IMG/M |
3300015289|Ga0182138_1066527 | Not Available | 549 | Open in IMG/M |
3300015292|Ga0182141_1011512 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 909 | Open in IMG/M |
3300015292|Ga0182141_1034355 | Not Available | 676 | Open in IMG/M |
3300015292|Ga0182141_1044766 | Not Available | 627 | Open in IMG/M |
3300015294|Ga0182126_1002937 | Not Available | 1332 | Open in IMG/M |
3300015294|Ga0182126_1042044 | Not Available | 642 | Open in IMG/M |
3300015295|Ga0182175_1040837 | Not Available | 654 | Open in IMG/M |
3300015295|Ga0182175_1043740 | Not Available | 641 | Open in IMG/M |
3300015295|Ga0182175_1053309 | Not Available | 606 | Open in IMG/M |
3300015295|Ga0182175_1063331 | Not Available | 576 | Open in IMG/M |
3300015295|Ga0182175_1068761 | Not Available | 562 | Open in IMG/M |
3300015295|Ga0182175_1072046 | Not Available | 554 | Open in IMG/M |
3300015295|Ga0182175_1085449 | Not Available | 526 | Open in IMG/M |
3300015296|Ga0182157_1038590 | Not Available | 674 | Open in IMG/M |
3300015296|Ga0182157_1040250 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 666 | Open in IMG/M |
3300015296|Ga0182157_1055143 | All Organisms → cellular organisms → Eukaryota | 609 | Open in IMG/M |
3300015296|Ga0182157_1061856 | Not Available | 589 | Open in IMG/M |
3300015296|Ga0182157_1069146 | Not Available | 569 | Open in IMG/M |
3300015296|Ga0182157_1077997 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 548 | Open in IMG/M |
3300015296|Ga0182157_1081968 | Not Available | 540 | Open in IMG/M |
3300015296|Ga0182157_1090080 | Not Available | 525 | Open in IMG/M |
3300015298|Ga0182106_1010458 | Not Available | 981 | Open in IMG/M |
3300015298|Ga0182106_1010797 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 972 | Open in IMG/M |
3300015298|Ga0182106_1035246 | Not Available | 692 | Open in IMG/M |
3300015298|Ga0182106_1040662 | Not Available | 665 | Open in IMG/M |
3300015298|Ga0182106_1079384 | Not Available | 545 | Open in IMG/M |
3300015298|Ga0182106_1086930 | Not Available | 530 | Open in IMG/M |
3300015299|Ga0182107_1014167 | Not Available | 898 | Open in IMG/M |
3300015299|Ga0182107_1034674 | Not Available | 700 | Open in IMG/M |
3300015299|Ga0182107_1057855 | Not Available | 604 | Open in IMG/M |
3300015299|Ga0182107_1074698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri | 559 | Open in IMG/M |
3300015299|Ga0182107_1105291 | Not Available | 501 | Open in IMG/M |
3300015300|Ga0182108_1004659 | Not Available | 1245 | Open in IMG/M |
3300015300|Ga0182108_1052977 | Not Available | 624 | Open in IMG/M |
3300015300|Ga0182108_1058909 | Not Available | 604 | Open in IMG/M |
3300015300|Ga0182108_1068309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei | 578 | Open in IMG/M |
3300015300|Ga0182108_1071302 | Not Available | 570 | Open in IMG/M |
3300015300|Ga0182108_1108061 | Not Available | 500 | Open in IMG/M |
3300015302|Ga0182143_1024847 | Not Available | 766 | Open in IMG/M |
3300015302|Ga0182143_1034904 | Not Available | 697 | Open in IMG/M |
3300015302|Ga0182143_1040098 | Not Available | 670 | Open in IMG/M |
3300015302|Ga0182143_1046434 | Not Available | 643 | Open in IMG/M |
3300015302|Ga0182143_1066281 | Not Available | 579 | Open in IMG/M |
3300015302|Ga0182143_1073450 | Not Available | 561 | Open in IMG/M |
3300015302|Ga0182143_1082773 | Not Available | 541 | Open in IMG/M |
3300015303|Ga0182123_1046131 | Not Available | 627 | Open in IMG/M |
3300015304|Ga0182112_1028108 | Not Available | 743 | Open in IMG/M |
3300015304|Ga0182112_1048283 | Not Available | 637 | Open in IMG/M |
3300015304|Ga0182112_1067675 | Not Available | 577 | Open in IMG/M |
3300015304|Ga0182112_1087239 | Not Available | 534 | Open in IMG/M |
3300015304|Ga0182112_1098976 | Not Available | 513 | Open in IMG/M |
3300015304|Ga0182112_1102783 | Not Available | 507 | Open in IMG/M |
3300015305|Ga0182158_1012585 | Not Available | 920 | Open in IMG/M |
3300015305|Ga0182158_1040661 | Not Available | 666 | Open in IMG/M |
3300015307|Ga0182144_1003008 | Not Available | 1391 | Open in IMG/M |
3300015307|Ga0182144_1008905 | Not Available | 1031 | Open in IMG/M |
3300015307|Ga0182144_1018112 | Not Available | 850 | Open in IMG/M |
3300015307|Ga0182144_1021019 | Not Available | 816 | Open in IMG/M |
3300015307|Ga0182144_1067246 | Not Available | 583 | Open in IMG/M |
3300015307|Ga0182144_1090715 | Not Available | 532 | Open in IMG/M |
3300015307|Ga0182144_1091010 | Not Available | 531 | Open in IMG/M |
3300015307|Ga0182144_1094248 | Not Available | 526 | Open in IMG/M |
3300015307|Ga0182144_1101595 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula | 513 | Open in IMG/M |
3300015308|Ga0182142_1018929 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 858 | Open in IMG/M |
3300015308|Ga0182142_1038130 | Not Available | 702 | Open in IMG/M |
3300015308|Ga0182142_1058076 | Not Available | 622 | Open in IMG/M |
3300015308|Ga0182142_1076717 | Not Available | 571 | Open in IMG/M |
3300015308|Ga0182142_1076965 | Not Available | 570 | Open in IMG/M |
3300015308|Ga0182142_1084905 | Not Available | 553 | Open in IMG/M |
3300015308|Ga0182142_1091282 | Not Available | 541 | Open in IMG/M |
3300015308|Ga0182142_1102592 | Not Available | 522 | Open in IMG/M |
3300015314|Ga0182140_1002828 | Not Available | 1449 | Open in IMG/M |
3300015314|Ga0182140_1038023 | Not Available | 705 | Open in IMG/M |
3300015314|Ga0182140_1041238 | Not Available | 689 | Open in IMG/M |
3300015314|Ga0182140_1048222 | Not Available | 658 | Open in IMG/M |
3300015314|Ga0182140_1059121 | Not Available | 620 | Open in IMG/M |
3300015314|Ga0182140_1064058 | Not Available | 605 | Open in IMG/M |
3300015314|Ga0182140_1066753 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 598 | Open in IMG/M |
3300015314|Ga0182140_1074812 | Not Available | 577 | Open in IMG/M |
3300015314|Ga0182140_1095024 | Not Available | 535 | Open in IMG/M |
3300015314|Ga0182140_1108437 | Not Available | 513 | Open in IMG/M |
3300015314|Ga0182140_1116662 | Not Available | 501 | Open in IMG/M |
3300015321|Ga0182127_1029479 | Not Available | 781 | Open in IMG/M |
3300015321|Ga0182127_1039140 | Not Available | 719 | Open in IMG/M |
3300015321|Ga0182127_1052198 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 661 | Open in IMG/M |
3300015321|Ga0182127_1077651 | Not Available | 586 | Open in IMG/M |
3300015321|Ga0182127_1091306 | Not Available | 557 | Open in IMG/M |
3300015322|Ga0182110_1022991 | Not Available | 836 | Open in IMG/M |
3300015322|Ga0182110_1082667 | Not Available | 573 | Open in IMG/M |
3300015322|Ga0182110_1093011 | Not Available | 552 | Open in IMG/M |
3300015322|Ga0182110_1099683 | Not Available | 540 | Open in IMG/M |
3300015322|Ga0182110_1124725 | Not Available | 502 | Open in IMG/M |
3300015323|Ga0182129_1031286 | Not Available | 742 | Open in IMG/M |
3300015323|Ga0182129_1036556 | Not Available | 710 | Open in IMG/M |
3300015323|Ga0182129_1049806 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 649 | Open in IMG/M |
3300015323|Ga0182129_1051464 | Not Available | 643 | Open in IMG/M |
3300015323|Ga0182129_1054544 | Not Available | 632 | Open in IMG/M |
3300015323|Ga0182129_1089499 | Not Available | 545 | Open in IMG/M |
3300015323|Ga0182129_1098627 | Not Available | 529 | Open in IMG/M |
3300015323|Ga0182129_1115843 | Not Available | 502 | Open in IMG/M |
3300015341|Ga0182187_1034672 | Not Available | 922 | Open in IMG/M |
3300015341|Ga0182187_1045290 | Not Available | 845 | Open in IMG/M |
3300015341|Ga0182187_1045812 | Not Available | 841 | Open in IMG/M |
3300015341|Ga0182187_1046174 | Not Available | 839 | Open in IMG/M |
3300015341|Ga0182187_1071400 | Not Available | 725 | Open in IMG/M |
3300015341|Ga0182187_1072047 | Not Available | 723 | Open in IMG/M |
3300015341|Ga0182187_1105415 | Not Available | 634 | Open in IMG/M |
3300015341|Ga0182187_1105871 | Not Available | 633 | Open in IMG/M |
3300015341|Ga0182187_1121149 | Not Available | 604 | Open in IMG/M |
3300015341|Ga0182187_1155100 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 552 | Open in IMG/M |
3300015342|Ga0182109_1020392 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1170 | Open in IMG/M |
3300015342|Ga0182109_1076602 | Not Available | 748 | Open in IMG/M |
3300015342|Ga0182109_1156821 | Not Available | 576 | Open in IMG/M |
3300015342|Ga0182109_1166780 | Not Available | 562 | Open in IMG/M |
3300015342|Ga0182109_1171021 | Not Available | 557 | Open in IMG/M |
3300015342|Ga0182109_1179871 | Not Available | 546 | Open in IMG/M |
3300015342|Ga0182109_1180022 | Not Available | 546 | Open in IMG/M |
3300015342|Ga0182109_1183404 | Not Available | 542 | Open in IMG/M |
3300015342|Ga0182109_1209531 | Not Available | 515 | Open in IMG/M |
3300015342|Ga0182109_1224862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei | 501 | Open in IMG/M |
3300015343|Ga0182155_1028867 | Not Available | 1025 | Open in IMG/M |
3300015343|Ga0182155_1051971 | Not Available | 846 | Open in IMG/M |
3300015343|Ga0182155_1073342 | Not Available | 753 | Open in IMG/M |
3300015343|Ga0182155_1082931 | Not Available | 722 | Open in IMG/M |
3300015343|Ga0182155_1094186 | Not Available | 690 | Open in IMG/M |
3300015343|Ga0182155_1097712 | Not Available | 682 | Open in IMG/M |
3300015343|Ga0182155_1130574 | Not Available | 615 | Open in IMG/M |
3300015343|Ga0182155_1137819 | Not Available | 603 | Open in IMG/M |
3300015343|Ga0182155_1138729 | Not Available | 602 | Open in IMG/M |
3300015343|Ga0182155_1151287 | Not Available | 583 | Open in IMG/M |
3300015343|Ga0182155_1176901 | Not Available | 550 | Open in IMG/M |
3300015343|Ga0182155_1217925 | Not Available | 508 | Open in IMG/M |
3300015344|Ga0182189_1109191 | Not Available | 664 | Open in IMG/M |
3300015344|Ga0182189_1120580 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 640 | Open in IMG/M |
3300015344|Ga0182189_1125427 | Not Available | 632 | Open in IMG/M |
3300015344|Ga0182189_1163922 | Not Available | 572 | Open in IMG/M |
3300015344|Ga0182189_1180847 | Not Available | 551 | Open in IMG/M |
3300015344|Ga0182189_1227589 | Not Available | 503 | Open in IMG/M |
3300015344|Ga0182189_1229515 | Not Available | 501 | Open in IMG/M |
3300015344|Ga0182189_1230005 | Not Available | 500 | Open in IMG/M |
3300015345|Ga0182111_1031691 | Not Available | 1065 | Open in IMG/M |
3300015345|Ga0182111_1087737 | Not Available | 743 | Open in IMG/M |
3300015345|Ga0182111_1104932 | Not Available | 696 | Open in IMG/M |
3300015345|Ga0182111_1114020 | Not Available | 675 | Open in IMG/M |
3300015345|Ga0182111_1121917 | Not Available | 658 | Open in IMG/M |
3300015345|Ga0182111_1123504 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 655 | Open in IMG/M |
3300015345|Ga0182111_1143624 | Not Available | 619 | Open in IMG/M |
3300015345|Ga0182111_1205024 | Not Available | 539 | Open in IMG/M |
3300015346|Ga0182139_1084632 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 754 | Open in IMG/M |
3300015346|Ga0182139_1088314 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 743 | Open in IMG/M |
3300015346|Ga0182139_1092972 | Not Available | 728 | Open in IMG/M |
3300015346|Ga0182139_1120028 | Not Available | 663 | Open in IMG/M |
3300015346|Ga0182139_1134168 | Not Available | 635 | Open in IMG/M |
3300015346|Ga0182139_1136362 | Not Available | 632 | Open in IMG/M |
3300015346|Ga0182139_1160569 | Not Available | 594 | Open in IMG/M |
3300015346|Ga0182139_1177697 | Not Available | 571 | Open in IMG/M |
3300015346|Ga0182139_1232202 | Not Available | 513 | Open in IMG/M |
3300015347|Ga0182177_1040314 | Not Available | 987 | Open in IMG/M |
3300015347|Ga0182177_1042748 | Not Available | 966 | Open in IMG/M |
3300015347|Ga0182177_1120165 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 664 | Open in IMG/M |
3300015347|Ga0182177_1122857 | Not Available | 659 | Open in IMG/M |
3300015347|Ga0182177_1129417 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 646 | Open in IMG/M |
3300015347|Ga0182177_1130909 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 644 | Open in IMG/M |
3300015347|Ga0182177_1134225 | Not Available | 638 | Open in IMG/M |
3300015347|Ga0182177_1163047 | Not Available | 592 | Open in IMG/M |
3300015347|Ga0182177_1166916 | Not Available | 587 | Open in IMG/M |
3300015347|Ga0182177_1174691 | Not Available | 577 | Open in IMG/M |
3300015347|Ga0182177_1222372 | Not Available | 525 | Open in IMG/M |
3300015347|Ga0182177_1225536 | Not Available | 522 | Open in IMG/M |
3300015347|Ga0182177_1241748 | Not Available | 508 | Open in IMG/M |
3300015351|Ga0182161_1006747 | Not Available | 1822 | Open in IMG/M |
3300015351|Ga0182161_1027844 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
3300015351|Ga0182161_1047332 | Not Available | 978 | Open in IMG/M |
3300015351|Ga0182161_1051271 | Not Available | 951 | Open in IMG/M |
3300015351|Ga0182161_1068542 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu | 855 | Open in IMG/M |
3300015351|Ga0182161_1069794 | Not Available | 849 | Open in IMG/M |
3300015351|Ga0182161_1082238 | Not Available | 798 | Open in IMG/M |
3300015351|Ga0182161_1092936 | Not Available | 762 | Open in IMG/M |
3300015351|Ga0182161_1113024 | Not Available | 707 | Open in IMG/M |
3300015351|Ga0182161_1127839 | Not Available | 674 | Open in IMG/M |
3300015351|Ga0182161_1133972 | Not Available | 662 | Open in IMG/M |
3300015351|Ga0182161_1171366 | Not Available | 601 | Open in IMG/M |
3300015351|Ga0182161_1184993 | Not Available | 584 | Open in IMG/M |
3300015351|Ga0182161_1238873 | Not Available | 526 | Open in IMG/M |
3300015351|Ga0182161_1250321 | Not Available | 516 | Open in IMG/M |
3300015355|Ga0182159_1004468 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2440 | Open in IMG/M |
3300015355|Ga0182159_1054881 | Not Available | 1085 | Open in IMG/M |
3300015355|Ga0182159_1108178 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 831 | Open in IMG/M |
3300015355|Ga0182159_1114166 | Not Available | 813 | Open in IMG/M |
3300015355|Ga0182159_1145355 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 736 | Open in IMG/M |
3300015355|Ga0182159_1147494 | Not Available | 731 | Open in IMG/M |
3300015355|Ga0182159_1152522 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 721 | Open in IMG/M |
3300015355|Ga0182159_1165909 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula | 696 | Open in IMG/M |
3300015355|Ga0182159_1175459 | Not Available | 680 | Open in IMG/M |
3300015355|Ga0182159_1190413 | Not Available | 656 | Open in IMG/M |
3300015355|Ga0182159_1195474 | Not Available | 649 | Open in IMG/M |
3300015355|Ga0182159_1218982 | Not Available | 618 | Open in IMG/M |
3300015355|Ga0182159_1228316 | Not Available | 607 | Open in IMG/M |
3300015355|Ga0182159_1254540 | Not Available | 579 | Open in IMG/M |
3300015355|Ga0182159_1257570 | Not Available | 576 | Open in IMG/M |
3300015355|Ga0182159_1302028 | Not Available | 537 | Open in IMG/M |
3300015355|Ga0182159_1325965 | Not Available | 519 | Open in IMG/M |
3300015355|Ga0182159_1348644 | Not Available | 504 | Open in IMG/M |
3300015361|Ga0182145_1002004 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1929 | Open in IMG/M |
3300015361|Ga0182145_1012434 | Not Available | 1201 | Open in IMG/M |
3300015361|Ga0182145_1032921 | Not Available | 900 | Open in IMG/M |
3300015361|Ga0182145_1053555 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 772 | Open in IMG/M |
3300015361|Ga0182145_1075476 | Not Available | 691 | Open in IMG/M |
3300015361|Ga0182145_1087750 | Not Available | 657 | Open in IMG/M |
3300015361|Ga0182145_1089758 | Not Available | 652 | Open in IMG/M |
3300015361|Ga0182145_1104624 | Not Available | 619 | Open in IMG/M |
3300015361|Ga0182145_1104915 | Not Available | 619 | Open in IMG/M |
3300015361|Ga0182145_1116690 | Not Available | 597 | Open in IMG/M |
3300015361|Ga0182145_1136944 | Not Available | 566 | Open in IMG/M |
3300015361|Ga0182145_1167815 | Not Available | 528 | Open in IMG/M |
3300015361|Ga0182145_1169840 | Not Available | 526 | Open in IMG/M |
3300015361|Ga0182145_1178838 | Not Available | 517 | Open in IMG/M |
3300017404|Ga0182203_1016218 | Not Available | 1027 | Open in IMG/M |
3300017404|Ga0182203_1053976 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 719 | Open in IMG/M |
3300017404|Ga0182203_1079770 | Not Available | 636 | Open in IMG/M |
3300017404|Ga0182203_1100241 | Not Available | 591 | Open in IMG/M |
3300017404|Ga0182203_1112258 | Not Available | 570 | Open in IMG/M |
3300017404|Ga0182203_1112795 | Not Available | 569 | Open in IMG/M |
3300017404|Ga0182203_1132749 | Not Available | 539 | Open in IMG/M |
3300017407|Ga0182220_1061342 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 592 | Open in IMG/M |
3300017407|Ga0182220_1085629 | Not Available | 538 | Open in IMG/M |
3300017407|Ga0182220_1093723 | Not Available | 524 | Open in IMG/M |
3300017407|Ga0182220_1095535 | Not Available | 521 | Open in IMG/M |
3300017409|Ga0182204_1012739 | Not Available | 971 | Open in IMG/M |
3300017409|Ga0182204_1017121 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 894 | Open in IMG/M |
3300017409|Ga0182204_1038159 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 709 | Open in IMG/M |
3300017409|Ga0182204_1048090 | Not Available | 663 | Open in IMG/M |
3300017409|Ga0182204_1077194 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 576 | Open in IMG/M |
3300017409|Ga0182204_1083260 | Not Available | 563 | Open in IMG/M |
3300017410|Ga0182207_1008498 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1290 | Open in IMG/M |
3300017410|Ga0182207_1018217 | Not Available | 1038 | Open in IMG/M |
3300017410|Ga0182207_1032602 | Not Available | 871 | Open in IMG/M |
3300017410|Ga0182207_1085730 | Not Available | 642 | Open in IMG/M |
3300017410|Ga0182207_1101883 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 606 | Open in IMG/M |
3300017410|Ga0182207_1104867 | Not Available | 601 | Open in IMG/M |
3300017410|Ga0182207_1166846 | Not Available | 512 | Open in IMG/M |
3300017411|Ga0182208_1023330 | Not Available | 843 | Open in IMG/M |
3300017411|Ga0182208_1056964 | Not Available | 649 | Open in IMG/M |
3300017411|Ga0182208_1059157 | Not Available | 642 | Open in IMG/M |
3300017411|Ga0182208_1076146 | Not Available | 595 | Open in IMG/M |
3300017411|Ga0182208_1108955 | Not Available | 531 | Open in IMG/M |
3300017413|Ga0182222_1011214 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 899 | Open in IMG/M |
3300017413|Ga0182222_1047429 | Not Available | 624 | Open in IMG/M |
3300017413|Ga0182222_1074361 | Not Available | 555 | Open in IMG/M |
3300017413|Ga0182222_1075116 | Not Available | 553 | Open in IMG/M |
3300017413|Ga0182222_1102057 | Not Available | 510 | Open in IMG/M |
3300017413|Ga0182222_1106261 | Not Available | 504 | Open in IMG/M |
3300017415|Ga0182202_1022609 | Not Available | 881 | Open in IMG/M |
3300017415|Ga0182202_1048565 | Not Available | 702 | Open in IMG/M |
3300017415|Ga0182202_1066003 | Not Available | 639 | Open in IMG/M |
3300017415|Ga0182202_1073598 | Not Available | 618 | Open in IMG/M |
3300017415|Ga0182202_1076637 | Not Available | 610 | Open in IMG/M |
3300017415|Ga0182202_1080101 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 601 | Open in IMG/M |
3300017415|Ga0182202_1110663 | Not Available | 542 | Open in IMG/M |
3300017415|Ga0182202_1127208 | Not Available | 517 | Open in IMG/M |
3300017417|Ga0182230_1040609 | Not Available | 815 | Open in IMG/M |
3300017417|Ga0182230_1074059 | Not Available | 611 | Open in IMG/M |
3300017417|Ga0182230_1088142 | Not Available | 566 | Open in IMG/M |
3300017420|Ga0182228_1056015 | Not Available | 683 | Open in IMG/M |
3300017420|Ga0182228_1070419 | Not Available | 627 | Open in IMG/M |
3300017420|Ga0182228_1089300 | Not Available | 575 | Open in IMG/M |
3300017424|Ga0182219_1036561 | Not Available | 763 | Open in IMG/M |
3300017424|Ga0182219_1042428 | Not Available | 728 | Open in IMG/M |
3300017424|Ga0182219_1126373 | Not Available | 519 | Open in IMG/M |
3300017424|Ga0182219_1129885 | Not Available | 515 | Open in IMG/M |
3300017425|Ga0182224_1005554 | Not Available | 1370 | Open in IMG/M |
3300017425|Ga0182224_1008209 | All Organisms → cellular organisms → Eukaryota | 1235 | Open in IMG/M |
3300017425|Ga0182224_1040294 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 783 | Open in IMG/M |
3300017425|Ga0182224_1048803 | Not Available | 739 | Open in IMG/M |
3300017425|Ga0182224_1062214 | Not Available | 686 | Open in IMG/M |
3300017425|Ga0182224_1078986 | Not Available | 638 | Open in IMG/M |
3300017425|Ga0182224_1094868 | Not Available | 602 | Open in IMG/M |
3300017425|Ga0182224_1100416 | Not Available | 592 | Open in IMG/M |
3300017425|Ga0182224_1126017 | Not Available | 550 | Open in IMG/M |
3300017425|Ga0182224_1147377 | Not Available | 522 | Open in IMG/M |
3300017427|Ga0182190_1040302 | Not Available | 809 | Open in IMG/M |
3300017427|Ga0182190_1045876 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 775 | Open in IMG/M |
3300017427|Ga0182190_1064840 | Not Available | 691 | Open in IMG/M |
3300017430|Ga0182192_1023448 | Not Available | 989 | Open in IMG/M |
3300017430|Ga0182192_1055447 | Not Available | 745 | Open in IMG/M |
3300017430|Ga0182192_1090757 | Not Available | 630 | Open in IMG/M |
3300017430|Ga0182192_1110145 | Not Available | 589 | Open in IMG/M |
3300017430|Ga0182192_1122305 | Not Available | 568 | Open in IMG/M |
3300017430|Ga0182192_1137197 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 546 | Open in IMG/M |
3300017430|Ga0182192_1169876 | Not Available | 505 | Open in IMG/M |
3300017433|Ga0182206_1142252 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu | 521 | Open in IMG/M |
3300017435|Ga0182194_1032860 | Not Available | 888 | Open in IMG/M |
3300017436|Ga0182209_1011444 | Not Available | 1148 | Open in IMG/M |
3300017436|Ga0182209_1041203 | Not Available | 793 | Open in IMG/M |
3300017436|Ga0182209_1047590 | Not Available | 759 | Open in IMG/M |
3300017436|Ga0182209_1050397 | Not Available | 745 | Open in IMG/M |
3300017436|Ga0182209_1055717 | Not Available | 723 | Open in IMG/M |
3300017436|Ga0182209_1057189 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 717 | Open in IMG/M |
3300017436|Ga0182209_1058136 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 713 | Open in IMG/M |
3300017436|Ga0182209_1080729 | Not Available | 644 | Open in IMG/M |
3300017436|Ga0182209_1153519 | Not Available | 523 | Open in IMG/M |
3300017436|Ga0182209_1162138 | Not Available | 514 | Open in IMG/M |
3300017438|Ga0182191_1034384 | Not Available | 871 | Open in IMG/M |
3300017438|Ga0182191_1050469 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 771 | Open in IMG/M |
3300017438|Ga0182191_1070680 | Not Available | 691 | Open in IMG/M |
3300017438|Ga0182191_1078301 | Not Available | 668 | Open in IMG/M |
3300017438|Ga0182191_1089172 | Not Available | 640 | Open in IMG/M |
3300017438|Ga0182191_1115826 | Not Available | 588 | Open in IMG/M |
3300017438|Ga0182191_1156767 | Not Available | 530 | Open in IMG/M |
3300017438|Ga0182191_1175102 | Not Available | 510 | Open in IMG/M |
3300017438|Ga0182191_1178710 | Not Available | 506 | Open in IMG/M |
3300017438|Ga0182191_1178825 | Not Available | 506 | Open in IMG/M |
3300017442|Ga0182221_1032352 | Not Available | 834 | Open in IMG/M |
3300017442|Ga0182221_1038740 | Not Available | 791 | Open in IMG/M |
3300017442|Ga0182221_1096940 | Not Available | 600 | Open in IMG/M |
3300017442|Ga0182221_1101723 | Not Available | 591 | Open in IMG/M |
3300017442|Ga0182221_1110771 | Not Available | 576 | Open in IMG/M |
3300017442|Ga0182221_1126305 | Not Available | 553 | Open in IMG/M |
3300017443|Ga0182193_1007860 | Not Available | 1368 | Open in IMG/M |
3300017443|Ga0182193_1053793 | Not Available | 778 | Open in IMG/M |
3300017443|Ga0182193_1088831 | Not Available | 662 | Open in IMG/M |
3300017443|Ga0182193_1102732 | Not Available | 630 | Open in IMG/M |
3300017443|Ga0182193_1136524 | Not Available | 572 | Open in IMG/M |
3300017443|Ga0182193_1143351 | Not Available | 562 | Open in IMG/M |
3300017443|Ga0182193_1187045 | Not Available | 512 | Open in IMG/M |
3300017443|Ga0182193_1191919 | Not Available | 507 | Open in IMG/M |
3300017443|Ga0182193_1199679 | Not Available | 500 | Open in IMG/M |
3300017680|Ga0182233_1041454 | Not Available | 810 | Open in IMG/M |
3300017681|Ga0182226_1059761 | Not Available | 694 | Open in IMG/M |
3300017682|Ga0182229_1094183 | Not Available | 528 | Open in IMG/M |
3300017683|Ga0182218_1010611 | Not Available | 1100 | Open in IMG/M |
3300017683|Ga0182218_1023287 | Not Available | 885 | Open in IMG/M |
3300017684|Ga0182225_1039819 | Not Available | 749 | Open in IMG/M |
3300017684|Ga0182225_1056534 | Not Available | 672 | Open in IMG/M |
3300017684|Ga0182225_1059621 | Not Available | 661 | Open in IMG/M |
3300017684|Ga0182225_1129596 | Not Available | 520 | Open in IMG/M |
3300017685|Ga0182227_1029164 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 952 | Open in IMG/M |
3300017685|Ga0182227_1060723 | Not Available | 685 | Open in IMG/M |
3300017685|Ga0182227_1096082 | Not Available | 573 | Open in IMG/M |
3300017685|Ga0182227_1099327 | Not Available | 566 | Open in IMG/M |
3300017685|Ga0182227_1112319 | Not Available | 540 | Open in IMG/M |
3300017686|Ga0182205_1032988 | Not Available | 864 | Open in IMG/M |
3300017686|Ga0182205_1052752 | Not Available | 743 | Open in IMG/M |
3300017686|Ga0182205_1100708 | Not Available | 602 | Open in IMG/M |
3300017686|Ga0182205_1149708 | Not Available | 526 | Open in IMG/M |
3300017686|Ga0182205_1171343 | Not Available | 502 | Open in IMG/M |
3300017690|Ga0182223_1018822 | Not Available | 839 | Open in IMG/M |
3300017690|Ga0182223_1102525 | Not Available | 531 | Open in IMG/M |
3300017690|Ga0182223_1104744 | Not Available | 528 | Open in IMG/M |
3300017690|Ga0182223_1105039 | Not Available | 527 | Open in IMG/M |
3300017690|Ga0182223_1124645 | Not Available | 502 | Open in IMG/M |
3300021060|Ga0182232_1084416 | Not Available | 515 | Open in IMG/M |
3300025901|Ga0207688_10030344 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 2980 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 92.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.13% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.23% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.23% |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 0.23% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.23% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070676_111826401 | 3300005328 | Miscanthus Rhizosphere | MTNVCFAETIKLGHGNGDQLGNHGGPAHTMEIVLVFKGWTTRLRMD* |
Ga0068869_1020116501 | 3300005334 | Miscanthus Rhizosphere | MITMTNVCFVEAIKLGHGNGDRLGYHGGHAPTMEIVLVFKG* |
Ga0068868_1014984022 | 3300005338 | Miscanthus Rhizosphere | MITMTNVCFAEAIKLGHGNGDRLGNHGGHAPTMEIVSVFKGWTTRLRMD* |
Ga0070675_1019850112 | 3300005354 | Miscanthus Rhizosphere | CFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0070673_1009720271 | 3300005364 | Switchgrass Rhizosphere | MTNVCFVEATKLGHGNGDRLGNRSGHAPTMEIISVFKGWTTRLRMTSSKCRLE |
Ga0070678_1007669031 | 3300005456 | Miscanthus Rhizosphere | QYKITMTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWTTRLRITSSKCQLKLERHLE* |
Ga0070678_1014234591 | 3300005456 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGDRLGNRGGHAPTMEIVSIFKGWTTRLRMTSSKCRLELE |
Ga0068867_1015157272 | 3300005459 | Miscanthus Rhizosphere | MTNVYFAEAIKLGHGNRDRLGYHGGHVPTMEIVSVFKGWTTRLRMD* |
Ga0068867_1015638321 | 3300005459 | Miscanthus Rhizosphere | MTNVCFAEVIKLGHGNGDQLGNQGGHAPTMEIVSVFKGWTTRLRM |
Ga0070672_1010317323 | 3300005543 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWTQG* |
Ga0068866_110489581 | 3300005718 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWTTRLR |
Ga0068870_107869071 | 3300005840 | Miscanthus Rhizosphere | MTNVCFADAIKLGHGNGDQSGNQSCHAPTMEIVSVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0068870_114347441 | 3300005840 | Miscanthus Rhizosphere | MITMTNVCFVEAIKLGHSNGDRLGYHGGHAPTMKIILVFKGWTTRLRID* |
Ga0097621_1008402782 | 3300006237 | Miscanthus Rhizosphere | MITMTNVCFAEAIKLGHDNGDRLSYHGGHAPTMEIILVFKGWTIRLRMD* |
Ga0068871_1017399081 | 3300006358 | Miscanthus Rhizosphere | VITVTNVCFAEAIKLGHGNGDRLGNHGCHAPTMEIV |
Ga0068865_1005798743 | 3300006881 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0068865_1014083132 | 3300006881 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGDRLGNRGYHAPTMEIVSVFKGRTTRLRITSSKCQLELERHLE* |
Ga0105244_105140871 | 3300009036 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNEDRLGYHDDHAPTMEIVLVFKGWTTRLRMTSSMCQLELERHLE* |
Ga0105245_120521061 | 3300009098 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWTTRLRMTSSKCRLEL |
Ga0105245_123667371 | 3300009098 | Miscanthus Rhizosphere | MCFVDAIKLGHGNSN*LGNHGCHAPTMEIVLVFKGWTTR |
Ga0105245_132615721 | 3300009098 | Miscanthus Rhizosphere | NVCFVDAIKLDHSNGNLLGNHGCHAPTMEIVLVFKGWTTRLRMD* |
Ga0105243_128293062 | 3300009148 | Miscanthus Rhizosphere | NVWFIEAIKLGYGNGDWLGKHGCHAPTMEIISVFKGWTTRLRMD* |
Ga0105242_128332411 | 3300009176 | Miscanthus Rhizosphere | MTNVYFVEAIKLGHGNGDQLGNQGGHAPTMEIVSVFKGWMTRLRID |
Ga0105246_117436651 | 3300011119 | Miscanthus Rhizosphere | VITMTNVCFAEAIKLGHGNGDRLGNHGCHAPTMEIVSVFKGLTTRLRMTSSKCRLELERHLE* |
Ga0157374_111210541 | 3300013296 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGDRLGNQGGHAPTMEIVSVFKGWTTRLMMD* |
Ga0157378_122198101 | 3300013297 | Miscanthus Rhizosphere | MTNVYFAEAVKLGHGNRDRLSYHGGHAPTMEIISVFKGWMTR |
Ga0157378_130881572 | 3300013297 | Miscanthus Rhizosphere | MTNVCFAETIKLGHGNGDRLGYHCGHAPTMEIVSVFKGWTTRLRMTSSKCR |
Ga0157377_113263051 | 3300014745 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGYRLDNQGCHAPTMEIVLVFI |
Ga0157376_116913711 | 3300014969 | Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGDQLGKQGGHAPTMEIISVFKGWTTWLRMTSSKCRLEF |
Ga0182122_10123321 | 3300015267 | Miscanthus Phyllosphere | NVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKG* |
Ga0182122_10285561 | 3300015267 | Miscanthus Phyllosphere | MTNVCFTKAIKLGHGNGDQLGNRGCHAPTMEIVSV |
Ga0182122_10435981 | 3300015267 | Miscanthus Phyllosphere | MINMCFTDAIKLGHDNGDRLGNQGGHAPTMEIVSVFKGWTTR |
Ga0182122_10476782 | 3300015267 | Miscanthus Phyllosphere | TTTNVCFVEAIKLGHGNGDRLGYHGGHAPMMKIILVFKG* |
Ga0182122_10552971 | 3300015267 | Miscanthus Phyllosphere | MTNVCFAEAIKLDHGNGN*LDNHGCHAPMMEIISVFKG |
Ga0182122_10672901 | 3300015267 | Miscanthus Phyllosphere | MTVTNVCFAETIKLGHGNGDRLGNHGCHAPTMKIVSV |
Ga0182154_10170681 | 3300015268 | Miscanthus Phyllosphere | VITVTNVCFVEAIKLGHGNRDRLGYHGGHVPTMEIVSVFKGWTTRLRMD* |
Ga0182154_10267882 | 3300015268 | Miscanthus Phyllosphere | MTNVSFVEAIKLGHGNGDRLGYHGGHAPTMEIVLVFK |
Ga0182113_10587291 | 3300015269 | Miscanthus Phyllosphere | VITMTNMCFAEAIKLGHGNGDRLGNHGGHAPTMEIVLVFKGWTTRLRMD* |
Ga0182188_10254021 | 3300015274 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLDLGNGDRLGYHGGHTPTMEIVSVFKGWTTKLRMD* |
Ga0182188_10451331 | 3300015274 | Miscanthus Phyllosphere | VCFIEAIKLGHGNGDRLGYHGGHAPTMEIILVFKGWMTRLRMD* |
Ga0182188_10612681 | 3300015274 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDQLGNRGCHAPTMEIISVFKGWATRLRMTSSKCRLELKRHLE* |
Ga0182172_10015231 | 3300015275 | Miscanthus Phyllosphere | MTNVCFVETIQLGHVNGDRLGNNGCHAPMMEIVSVFKGWTTRLRM |
Ga0182172_10537191 | 3300015275 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGGHAPTMEIVSIFKGWTTRLRMD* |
Ga0182170_10085361 | 3300015276 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVLV |
Ga0182170_10089401 | 3300015276 | Miscanthus Phyllosphere | MITVTNVSFAEAIKLGHGNGDRLGNHGGHAPTMEIVSVFKGWTTRLRMD* |
Ga0182170_10188931 | 3300015276 | Miscanthus Phyllosphere | VTNVCFAEAIKLGPDNGDRLGYHGGHAPMMEIVLVFKVWMTRLRMD* |
Ga0182170_10451101 | 3300015276 | Miscanthus Phyllosphere | MTNVYFAEAIKLGHGNGDRLGNHGGHAPTMEIISVFKGRTARLRI |
Ga0182170_10689861 | 3300015276 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHSNGDQLGNRGCHAPTMEIVSVFKGWMTRLRMTSSKCPLELERHLE* |
Ga0182128_10175661 | 3300015277 | Miscanthus Phyllosphere | VTNVCFAEAIKIGHDNGDRLGNHGCHAPTIEIILVFKG |
Ga0182128_10313701 | 3300015277 | Miscanthus Phyllosphere | MPCPYNVCFAETIKLGHGNGDRLGNHGCHAPTMEIISVSK |
Ga0182128_10333512 | 3300015277 | Miscanthus Phyllosphere | MTNVCFAEAIKLGLGNGN*LGNHGFHAPTMEIILVFK |
Ga0182174_10432931 | 3300015279 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGYHGGHAPMMEIILVFKGWTTRLRMD* |
Ga0182160_10243391 | 3300015281 | Miscanthus Phyllosphere | MCFAEAIKLGHGNGDRLGNHGCHAPTMEIVLVFKG |
Ga0182160_10447881 | 3300015281 | Miscanthus Phyllosphere | YMITATNVCFTEAIKLGHGNGDRLGYHGGHAPMMEIVSVFKRWTTRLRID* |
Ga0182160_10777402 | 3300015281 | Miscanthus Phyllosphere | MTNVCFAETIKLGHGNGD*LGNHGGHAPTMESFSVFKGWT |
Ga0182124_10322201 | 3300015282 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNRDRLGNHGCHAPTMEIVLVFKGWTTRLRMTSSKCRL |
Ga0182124_10347912 | 3300015282 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNQGCHAPTMEIVSVFKGWTTRLRIT |
Ga0182124_10555961 | 3300015282 | Miscanthus Phyllosphere | MITVTNVCFVEAIKLGHGNGDRLGNHGGHAPTMEI |
Ga0182124_10668021 | 3300015282 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQGGHVPMMEIVLVFKGWMTRLRMD* |
Ga0182156_10237632 | 3300015283 | Miscanthus Phyllosphere | VCFAEAIKLGHGNGDRLGNHGDHAPTMEIVSVFKGWTTRLRM |
Ga0182156_10428371 | 3300015283 | Miscanthus Phyllosphere | MTNMCFAEAIELGHGNGDRLGNQGGHAPTIEIISVFKGWTIRLRMTSSKC |
Ga0182156_10592311 | 3300015283 | Miscanthus Phyllosphere | MANVCFAEAIKLGHGNGD*LGYPGGHAPMIENISVVKG*TTRIRM |
Ga0182156_10649841 | 3300015283 | Miscanthus Phyllosphere | VYFVEAIKLGHGNGDRLGNHGCHAPTMEIVLVFKGWTTRL |
Ga0182156_10733081 | 3300015283 | Miscanthus Phyllosphere | IKLGHGNGDRLGNQSGHAPTTEIILVFKGWTTRLRRDEF* |
Ga0182186_10227921 | 3300015285 | Miscanthus Phyllosphere | MTNVCFADAIKLGHGNGDRLGNRGCHAPTMEIVSVFKG*TTMLRMTSSK |
Ga0182186_10248482 | 3300015285 | Miscanthus Phyllosphere | MTNVCLVEAIKLGHGNVDRLGNHGCHAPTMKIVLIFKGWTTRLRMTSSKCRL |
Ga0182186_10412021 | 3300015285 | Miscanthus Phyllosphere | MCFAEAIKLCHGNGDRLGNHGGHAPTMEIISVFKGWT |
Ga0182186_10612141 | 3300015285 | Miscanthus Phyllosphere | MCVLQRHIKLGHGNRDRLGNRGCHAPTKEIISVFKGLTTRLSMTSSK |
Ga0182186_10613271 | 3300015285 | Miscanthus Phyllosphere | MTNVCFAEAIKLGQGNGDRLGNQGCHAPTMEIVSVFKEWTKMLMMD* |
Ga0182186_10660091 | 3300015285 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDLLGNHGYHAPTMDIVLIFKGSMTR |
Ga0182176_10318611 | 3300015286 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNEDRLGNQSCHAPSMEIVSVFKGWTTRLRMTSS |
Ga0182176_10433851 | 3300015286 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNRGSHAPTMEIVSVFKGWTTRLRITSSKCQLKLERHLE |
Ga0182176_10440341 | 3300015286 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHSNGDQLGNQGGHAPTMKIVSVFKGWTTRLRMTSSKCRLELE* |
Ga0182176_10519321 | 3300015286 | Miscanthus Phyllosphere | IKLGHSNEDQLGNQGGHAPMMEIVLVFKGWTTRLRMSSSKCRLVLERHLE* |
Ga0182176_10549331 | 3300015286 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNRGGHAPMMEIVSVFKGWTTRLRMTSSKC |
Ga0182171_10306961 | 3300015287 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNRGGHAPTMEIVSVFKGWMTRLRMTSSKCRLELERHLE* |
Ga0182171_10315933 | 3300015287 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGNHGCHAPTMEIVLVFKGWTT |
Ga0182171_10564021 | 3300015287 | Miscanthus Phyllosphere | VTNVCFVEAIKLGHGNGDRLGYHGGHAPMMEIISVFKGWMTRSRMN |
Ga0182171_10591431 | 3300015287 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGCHAPTMEIVLVF |
Ga0182171_10715152 | 3300015287 | Miscanthus Phyllosphere | FAEAIKLGHGNGDRLDNHGGHASTMEIVSIFKGWMTRLRTN* |
Ga0182173_10119261 | 3300015288 | Miscanthus Phyllosphere | MCFAEAIKLGHGNGDRLGNRGGHAPTMEIISVFKGWTTRLR |
Ga0182173_10135153 | 3300015288 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHDNGDRLGNRGGHAPTMEIVSVFKGWTT |
Ga0182173_10138612 | 3300015288 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNRGGHAPTMEIISVFKGWTTRLR |
Ga0182173_10284741 | 3300015288 | Miscanthus Phyllosphere | VYFAEAIKLGHGNGDRLGNNGCRAPTMEIFLIFKGWTA |
Ga0182173_10303841 | 3300015288 | Miscanthus Phyllosphere | MTNVCFAEAIKLGYGNGDQLGNHGGHAPTMEIVSVFKG |
Ga0182173_10647461 | 3300015288 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNSDRLGNHGCHAPTMEIVSVFKGWTTR |
Ga0182138_10242611 | 3300015289 | Miscanthus Phyllosphere | MCFAEAIKLGHSNGDRLGYHGCHAPTIEIISVFKGWTTRLMM |
Ga0182138_10443671 | 3300015289 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGDHGVMPTMEIVSVCKGWTTRLRMTSSK |
Ga0182138_10654391 | 3300015289 | Miscanthus Phyllosphere | TVTNVCFAEAIKLGHSNGDQLGYHNGHAPMIEIILVFKGWTTRLRMS* |
Ga0182138_10665271 | 3300015289 | Miscanthus Phyllosphere | MTNVCFAEAFKLGHGNVDQLGNQGGHAPTIETVSVFKGRTTRLRMTSSKCRLELERHLE* |
Ga0182141_10115123 | 3300015292 | Miscanthus Phyllosphere | MCFAEAIKLGHGNGDRLGYHGGHAPTMKIVSVFKGWT |
Ga0182141_10343551 | 3300015292 | Miscanthus Phyllosphere | MTNVCFTEAIKLGHSNGDQLGNYGGHAPTMEIISVFKGWMTMLRMD* |
Ga0182141_10447661 | 3300015292 | Miscanthus Phyllosphere | VCFAEAIKLGHGNGDQLGNHGGHAPTIEIVSVFKEWTTRLR |
Ga0182126_10029373 | 3300015294 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDRLGYHGGHAPTMEIVL |
Ga0182126_10420441 | 3300015294 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGNHGCHAPTMEIVSVFKGWTTRLRMTSSKCRLELE |
Ga0182175_10408371 | 3300015295 | Miscanthus Phyllosphere | MTNVCFVETVKLGHGNGDRLGIQRGHAPTMEIVSVFK |
Ga0182175_10437401 | 3300015295 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGYHYGHAPTMEIVSVFKGWTSSKCQLEW |
Ga0182175_10533092 | 3300015295 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQSCHAPSMEIVSVFKGWMTRLRMTSSKCRLELERHL |
Ga0182175_10633311 | 3300015295 | Miscanthus Phyllosphere | VITVNNVCFTEAIKLGHGNGDRLGNHGGHAPTMEIVS |
Ga0182175_10687611 | 3300015295 | Miscanthus Phyllosphere | MTNVYFADAIKLGHGNGDRLGNQGGHAPTMEIVSVFKGWTTRLRM |
Ga0182175_10720461 | 3300015295 | Miscanthus Phyllosphere | MTNVCFAEAIKLDYGNGN*LGNHDCHAPTMEIILVLKGWT |
Ga0182175_10854491 | 3300015295 | Miscanthus Phyllosphere | NVCFVEAIKLGHGNGDRLGNHGGHAPTMEIVSVFKGWTTRLRMD* |
Ga0182157_10385901 | 3300015296 | Miscanthus Phyllosphere | MTNVCFAYAIKLGHGNGDQSGNQSCHAPTMEIVSV |
Ga0182157_10402501 | 3300015296 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDQLGNQGGHAPTMEIVSVFKGWTTRLRMTSSKCRLELE* |
Ga0182157_10551432 | 3300015296 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNEDRLGNQSCHAPSMEIVSVFKGWM |
Ga0182157_10618561 | 3300015296 | Miscanthus Phyllosphere | VITVTNVCFADAIKLGHGNGDRLGNHGGHAPTMEFVSVFKGWTTRLRMD* |
Ga0182157_10691461 | 3300015296 | Miscanthus Phyllosphere | LGHGNGDQLGNHGGHAPTMEIVLVFKGWTTRLRMD* |
Ga0182157_10779971 | 3300015296 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGIQGGHAPTMEIISVF |
Ga0182157_10819681 | 3300015296 | Miscanthus Phyllosphere | MIIMTNVCFADAIKLGHGNGN*LGNHGCHAPTMEIVL |
Ga0182157_10900801 | 3300015296 | Miscanthus Phyllosphere | MTNVCFAEVIKLGHGNGDRLGNRGYHAPTMEIVSVFKGRTT |
Ga0182106_10104581 | 3300015298 | Miscanthus Phyllosphere | MITVTNVCFADAIKLGHGNGN*LGKHGCHAPTMEIVSVF |
Ga0182106_10107971 | 3300015298 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGDHGGHAPTMEIVSVFK |
Ga0182106_10352461 | 3300015298 | Miscanthus Phyllosphere | MTNVYFAETIKLGHSNGDRLGNRGGHALIMEIVSVFKGWTTRLRMTSSKYRLELERHVE* |
Ga0182106_10406621 | 3300015298 | Miscanthus Phyllosphere | MITKTNVCFAEAIELGHGNEDRLGYNDGHAPMMEIVSVFKGWTTRFRMD* |
Ga0182106_10793841 | 3300015298 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNRGGHAPTMEIVLVFKGWTTRLR |
Ga0182106_10869301 | 3300015298 | Miscanthus Phyllosphere | MTNVCFAGAIKLGHGNGDQLGNQGGHAPMMEIILVFKG* |
Ga0182107_10141671 | 3300015299 | Miscanthus Phyllosphere | MITMTNVCFVEAIKLGHSNGDRLGYHGGHAPTMEIISVFKGWTTR |
Ga0182107_10346741 | 3300015299 | Miscanthus Phyllosphere | MINVCFAEAIKLGHGNGDRLGNQGCHTPMMEIVSVFKGWTTRL |
Ga0182107_10578551 | 3300015299 | Miscanthus Phyllosphere | CFAEAIKLGHGNRDRLGDHGCHAPTMEIILVFKGWTTRLRMTSSKCRLELKRHLE* |
Ga0182107_10746982 | 3300015299 | Miscanthus Phyllosphere | VITVTNMCFAEAIKLSHGNGDRLGNHGGHAPTMEIVSVFKGWTTRL |
Ga0182107_11052911 | 3300015299 | Miscanthus Phyllosphere | CFAEAIKLGHGNRDRLGNRGCHAPTIEIVSVFKGWMIRLRMTSSKCCLE* |
Ga0182108_10046591 | 3300015300 | Miscanthus Phyllosphere | MTNVYFAEAIKLGHGNGDQLGNQGGHAPTMEIVSVFKGWTTR |
Ga0182108_10529771 | 3300015300 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDQLGNQGGHAPMMEIIFVFKGWTTRLRMTSSKCRLELE |
Ga0182108_10589091 | 3300015300 | Miscanthus Phyllosphere | VTNVCFADAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWTTRLRMTSSK |
Ga0182108_10683091 | 3300015300 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGIGDRLGYHGGHAPTMEIVSVFKGWTTR |
Ga0182108_10713021 | 3300015300 | Miscanthus Phyllosphere | KITMTNVCFAEAIELGHGNGDRLGNQGCHAPMMEIVSVLKDGRQG* |
Ga0182108_11080611 | 3300015300 | Miscanthus Phyllosphere | EAKLGHGNGDRLGYHGGHAPTMEIVLVFKGWMTRLRMD* |
Ga0182143_10248471 | 3300015302 | Miscanthus Phyllosphere | VTNVCFVEAIKLGHGNGDRLGNRGCHAATMEIISVFKGRTTRLRITSSKCQLELERHLE* |
Ga0182143_10349041 | 3300015302 | Miscanthus Phyllosphere | MVTITNVCFAEAIKLSHGNGDRLGNHVGHAPTMEIISVFKGWTTRLRTD* |
Ga0182143_10400982 | 3300015302 | Miscanthus Phyllosphere | MCLAEAIKLGHDNEDRLGYHGGHAPTMEIVLVFKGWTTRLRMD |
Ga0182143_10464341 | 3300015302 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGHGDRLGNRGGHAPTMEIVSVFKGWTTRLRMTSSKC |
Ga0182143_10662811 | 3300015302 | Miscanthus Phyllosphere | MCFAEAIKLGHGNGNRLGNQGCHAPTMEIVSVFKGWMTRLRI |
Ga0182143_10734501 | 3300015302 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGGHAPTMEIILVFKG |
Ga0182143_10827731 | 3300015302 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLSYHGGHAPTMEIVSVFKG*TTRLRMD |
Ga0182123_10461311 | 3300015303 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGYHGGHAPTMEIIVFKGWMIKLRMD* |
Ga0182112_10281081 | 3300015304 | Miscanthus Phyllosphere | EAIKLGHGNGDRLGNQGGHAPTMEIVSVFKGWTTRLRTY* |
Ga0182112_10482831 | 3300015304 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGGHAPTMEIISVFK |
Ga0182112_10676752 | 3300015304 | Miscanthus Phyllosphere | VITMTNVCFAEAIKLDHGNGDRLGIQGGHAPTMEIVSVFKGWTSSKCRLELRRYLE* |
Ga0182112_10872391 | 3300015304 | Miscanthus Phyllosphere | CFIEAIKLGHGNGDRLGNHGGHAPTMEIISVFKGWTTRLRMD* |
Ga0182112_10989761 | 3300015304 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNYGCHAPTMEIISVFKGWTIRL |
Ga0182112_11027831 | 3300015304 | Miscanthus Phyllosphere | MCFVEAIKLGHGNGDQLGNQGGHAPTMKIVSVFKGWTTRLRVTSSKCRLE |
Ga0182158_10125851 | 3300015305 | Miscanthus Phyllosphere | MTNICFAEAIKLGHGNGNLLGNHGCHAPTMEIVLVFKGWTTRLRM |
Ga0182158_10406611 | 3300015305 | Miscanthus Phyllosphere | MTNVCFAEANKLGHGNGDRLGDHGCHAPTMEIVSVFNGWTTRLRMTSSKCRLELERHLE* |
Ga0182144_10030081 | 3300015307 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGKGDRLGNRGCHAPTMEIVSVFKGWTTRLRMTSSKCRLELEGH |
Ga0182144_10089051 | 3300015307 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNEDRLGNQSWHAPSMEIVSIFK |
Ga0182144_10181121 | 3300015307 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGGHTPTMEIVSVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0182144_10210191 | 3300015307 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGNHGCHAPTMEIVSVFKGWTTR |
Ga0182144_10672461 | 3300015307 | Miscanthus Phyllosphere | MTSVCFTKAIKLGHGNGDRLGNRGGHAPTMEIISIFKGWSTRLRMTSSKCRLELKRH |
Ga0182144_10907151 | 3300015307 | Miscanthus Phyllosphere | INMTNVCFAQAIKLDHGNGDRLGYHDGHAPTMEIVSVFKRWMTRLRMD* |
Ga0182144_10910101 | 3300015307 | Miscanthus Phyllosphere | MTNMYFAEAIKLSHGNGDRLGYHGGHGPTMEIVSVFKGRMTRLRMN* |
Ga0182144_10942481 | 3300015307 | Miscanthus Phyllosphere | MTNVYFVEAIKLGHGNEDRLGNQSCHAPSMEIVLVFKGWTTRLRMTSSKCRLELERHLEEFRTLFFLWPYY* |
Ga0182144_11015952 | 3300015307 | Miscanthus Phyllosphere | MINVTNVCFAETIELGHGNGDRMGNQGCHAPTMEIVSVFK |
Ga0182142_10189291 | 3300015308 | Miscanthus Phyllosphere | MITMTNVCFVGAIKLGHGNGDRLGNHGGHAPTMEIVSIFKGW |
Ga0182142_10381301 | 3300015308 | Miscanthus Phyllosphere | MTNVCFADAIKLGHDNGDQLGNQSCHAPTMEIVSVFKGWTTR |
Ga0182142_10580761 | 3300015308 | Miscanthus Phyllosphere | MINMCFTDAIKLGHDNGDRLGNQGGHAPTMEIVSVFKGWTTRLR |
Ga0182142_10767171 | 3300015308 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNEDRLGNQSCHAPSMEIVSVFKGWMTRLTM |
Ga0182142_10769651 | 3300015308 | Miscanthus Phyllosphere | MTNVCFVEANKLGHGNGDQLGNQGCHAPTMEIVSVFKGWTTRLRMTSSKCRLE |
Ga0182142_10849051 | 3300015308 | Miscanthus Phyllosphere | MITVTNVCFAEAIKLGHGNGDRLGYHDGHAPMMEIVSVFKGWTTRLRMD* |
Ga0182142_10912821 | 3300015308 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNQGGHAPTMEIVLVFKGWMTRLRMTSSKCQLELERHLE* |
Ga0182142_11025921 | 3300015308 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLDHGNGDRLGYHDGHAPMMEIVLVFKGWTSSKC* |
Ga0182140_10028282 | 3300015314 | Miscanthus Phyllosphere | VITVTNVYFVETIKLGHSNGDRMGNQGGHAPTMEIVLVLKGWMTRLRM |
Ga0182140_10380232 | 3300015314 | Miscanthus Phyllosphere | MINVCFADAIKLGHGNGDRLGNQGGHAPMMEIVSVFKGW |
Ga0182140_10412381 | 3300015314 | Miscanthus Phyllosphere | VITVTNVCFAEAMKLGHGNGDRLGNHGGHAPTMEIVSIFKGWTTRLRMTSSKCRLEL |
Ga0182140_10482221 | 3300015314 | Miscanthus Phyllosphere | MCFAEAIKLDHDNGDRLGNRGCHAPTMEIVSVFEGWTTRLRMTSSKCRLELK |
Ga0182140_10591211 | 3300015314 | Miscanthus Phyllosphere | FTETIKLGHGNRDRMDNQGCYAPTMQIVSVFKGWTTRLMID* |
Ga0182140_10640581 | 3300015314 | Miscanthus Phyllosphere | MINVCFAEAIKLGHGNGDRLVNRGGHAPTMEIISVFKGWTTRLRMTSSKCQLELE |
Ga0182140_10667531 | 3300015314 | Miscanthus Phyllosphere | MIIMTNVCFTEAIKLGHVNGDRLGYHGDHAPTMEIVSVFKG |
Ga0182140_10748121 | 3300015314 | Miscanthus Phyllosphere | IKLGHGNGDRLGYHGGRAPTKELISGFKGWTTRLRMDWF* |
Ga0182140_10950241 | 3300015314 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDQLGNQGGHAPTMEIISVFKGWTTRLRMTSSKCRLELKRHLE* |
Ga0182140_11084371 | 3300015314 | Miscanthus Phyllosphere | MCFTEAIKLGHGNGDRLGYHGGHAPTMEIVSVFKGW |
Ga0182140_11166621 | 3300015314 | Miscanthus Phyllosphere | VCFAEAIKLGHGNGDRLGNHGGHAPMMEFVLVFKGWTTRLRMD* |
Ga0182127_10294791 | 3300015321 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHSNGDQLGNQGGHAPTMEIVLVFKEWTTRLRMTSSKCRLELERHLE* |
Ga0182127_10391401 | 3300015321 | Miscanthus Phyllosphere | MSNVCFAEAIKLGHGYGDRLGNQGSHAPTMEIISVFKGWTTRL |
Ga0182127_10521981 | 3300015321 | Miscanthus Phyllosphere | MITMTNVCFAEAIKLGHDNGDQLGNQGGHAPTMEIISVFKGWTTRLR |
Ga0182127_10776511 | 3300015321 | Miscanthus Phyllosphere | MTNVCFAYAIKLGHGNGDQSGNQSCHAPTMEIVSVFKGWTT |
Ga0182127_10913061 | 3300015321 | Miscanthus Phyllosphere | MCFVEAIKLGHDNEDRFGNHGGHASMMEIILVFKGWTTRLMMD* |
Ga0182110_10229911 | 3300015322 | Miscanthus Phyllosphere | VTNVCFAEAIKLCHGNGDRSGDHGSHAPTMEIISVFKGWTTRLRMTSSKCQLELERHLE |
Ga0182110_10826671 | 3300015322 | Miscanthus Phyllosphere | MCFVEAIKLGHGNGDRLGYHGGHAPTMEIVLVFKGW |
Ga0182110_10930111 | 3300015322 | Miscanthus Phyllosphere | MTNVCFAEAFKLGHGNGDRLGNRGCHAPTMEIVSVFKGRT |
Ga0182110_10996831 | 3300015322 | Miscanthus Phyllosphere | TIKLGHGNGDRLGNHGGHAPTMEIVSVFKGWTTRLRMN* |
Ga0182110_11247251 | 3300015322 | Miscanthus Phyllosphere | MTNVYFTETIKLGLGNGDRLGNRGCHAPTMEIVSVFKGWTTRLRMTS |
Ga0182129_10312861 | 3300015323 | Miscanthus Phyllosphere | MTNVCFAEAIKLGYGNGDRLGNRGGHAPTMEIVLVFKGWTTRLRMTSSKCRLELE* |
Ga0182129_10365561 | 3300015323 | Miscanthus Phyllosphere | MINMTNVCFAQAIKLDHGNGDRLGYHGGHAPTMEIVSVFKGWMARLRMD* |
Ga0182129_10498061 | 3300015323 | Miscanthus Phyllosphere | MTNVCFAEAIKLGYGNGDRLGNQGGHAPTMETVTSRPRA* |
Ga0182129_10514642 | 3300015323 | Miscanthus Phyllosphere | MTNVCFAEATKFGHGNGDRLGNRGGHAPTMEIVSVFKGWTTMLRMTSSKCRLEL |
Ga0182129_10545441 | 3300015323 | Miscanthus Phyllosphere | VTNVCFVEAIKLGHGNGDRLGNHGCHAPTMEIISVFKGWTTRLRMTSSKCRLEL |
Ga0182129_10894991 | 3300015323 | Miscanthus Phyllosphere | MTNV*FTYAIKLGRGNDN*LGNHGCHAPTMEIVSVFKG |
Ga0182129_10986271 | 3300015323 | Miscanthus Phyllosphere | MTNVCFVEAIKLGYGNGDRLGYYGGHAPIMEIVLVFKGWTTRLRMD* |
Ga0182129_11158431 | 3300015323 | Miscanthus Phyllosphere | MITVTNVCFAEAIKLGHGNGDRLGNQGCHAPMMEIVL |
Ga0182187_10346721 | 3300015341 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQSCHAPTMEIVSVFKGWMTRLRMDYFSKCCLVLKRHLD |
Ga0182187_10452901 | 3300015341 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNRGGHAPMMEIVLVFKGWTTRLR |
Ga0182187_10458121 | 3300015341 | Miscanthus Phyllosphere | MTNVCFAEAIELGHGNGDRLGNQGGHAPTMEIVSVFKGW |
Ga0182187_10461741 | 3300015341 | Miscanthus Phyllosphere | VITVTNVCFVEAIKLGHGNRDRLGYHGGHVPTMEIVSVFKEWTTRLRMD* |
Ga0182187_10714001 | 3300015341 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDRLGYHGGHAPTMEIVSVFKGWTTR |
Ga0182187_10720471 | 3300015341 | Miscanthus Phyllosphere | MCFAETIKLGHGNGDRLGNHGCHAPTMEIVSVFKGW |
Ga0182187_11054151 | 3300015341 | Miscanthus Phyllosphere | MITVTNVCFAEAIELGHGNGDRLSNHGGHAPTMEIVLVFKEWTTRLRMD* |
Ga0182187_11058711 | 3300015341 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNRGYHAPTMEIVLVFKGRTTRLRITSSKCQLELERH |
Ga0182187_11211491 | 3300015341 | Miscanthus Phyllosphere | MTNVCFAEANKLGHGNGDQLGNQGCHAPTMEIISVFKGWTTR |
Ga0182187_11551001 | 3300015341 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHDNGN*LGNHGCHAPTIEIISV |
Ga0182109_10203922 | 3300015342 | Miscanthus Phyllosphere | MITVTNVCFAESIKLGHGNGDRLGYHDGHAPTMEIVSVFK |
Ga0182109_10766022 | 3300015342 | Miscanthus Phyllosphere | VITLTNVCFAEVIKLGHGNGDRLGNHGGHAPTMEIVSVF |
Ga0182109_11568211 | 3300015342 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHSNRDRLGNHGCHAPTMEIVSVFKGWTTRLRMTSS |
Ga0182109_11667801 | 3300015342 | Miscanthus Phyllosphere | MTNVCFAQANKLGHGNGDRLGNHGCHAPTMEIVSAFKGWTTRLR |
Ga0182109_11710212 | 3300015342 | Miscanthus Phyllosphere | MTNMCFAEAIKLGHSNGDQLGNQGGHAPTMEIVLVFKGWTTRLRMTSSKCRLEL |
Ga0182109_11798711 | 3300015342 | Miscanthus Phyllosphere | TMTNVCFAEAIKLSHGNGGRLGNHGGHAPTMEIVLVFKGWTTRLMMD* |
Ga0182109_11800221 | 3300015342 | Miscanthus Phyllosphere | VTNVCFAETIELGHGNGDRLGNHGCHAPTMEIISGFKGWTTRLRMS* |
Ga0182109_11834041 | 3300015342 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDQLGNRGGHAPTMEIVSVFKGWTTRLRMSSS |
Ga0182109_12095311 | 3300015342 | Miscanthus Phyllosphere | MITVTNMCFAEAIKLGHGNGDRLGYHGGHVPTMEIVSVFKGWTSSKCRLVLRRHLE* |
Ga0182109_12248621 | 3300015342 | Miscanthus Phyllosphere | MTNMCFAEAIKLGHSNEDRLGNHGCHAPTMEIVSVFK |
Ga0182155_10288671 | 3300015343 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNHGGHAPTMEIISV |
Ga0182155_10519711 | 3300015343 | Miscanthus Phyllosphere | VITVTNVCFVDAIKLGHGNGDRLGNHGGHAPTMEIVSV |
Ga0182155_10733421 | 3300015343 | Miscanthus Phyllosphere | KLGYGNGDRLGNHGGHAPTMEIVSVFKGWTTRLRMD* |
Ga0182155_10829311 | 3300015343 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHDNGDRLGNHGGHAPTMEIVSVFKGWTTRL |
Ga0182155_10941861 | 3300015343 | Miscanthus Phyllosphere | TNVCFAEAIKLGHGNGDRLGNHGGHAPTMEIVSVFKGWSTRLRMD* |
Ga0182155_10977122 | 3300015343 | Miscanthus Phyllosphere | MTNVCFADAIKLGHGNGDQLGNQGCHASTMEIVSVFKGW |
Ga0182155_11305741 | 3300015343 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNQGGHAPTMEIVLVFKGWTTRLRMTSSKYRLELERHLE* |
Ga0182155_11378191 | 3300015343 | Miscanthus Phyllosphere | MTNMCFAEAIKLGHGNDN*LGNHGCHAPTMEIVLVFKGWTT |
Ga0182155_11387292 | 3300015343 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLDNYDGHAPTMKIILVFKGWMTRLMMD* |
Ga0182155_11512871 | 3300015343 | Miscanthus Phyllosphere | VITVTNVCFAEEIKLCHSNEDRLGNHGGHAPTMEIVSVFKGWTTRLRMD |
Ga0182155_11769011 | 3300015343 | Miscanthus Phyllosphere | MTNVCFAEVIKLGHGNGDQLGNQGGHTPTMEIVSVFKGWTTRLRMTSSKCRLELE* |
Ga0182155_12179251 | 3300015343 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHDNGDRLGNRGYHAPTMEIVSVFKGRT |
Ga0182189_11091911 | 3300015344 | Miscanthus Phyllosphere | VTNVCFVEAIKLGHGNGDRLGNRGCQAPTMEIVSVFKGWMTRLRMTSSKCRLELKRHLE* |
Ga0182189_11205803 | 3300015344 | Miscanthus Phyllosphere | VTNVGFAEANKLGHGNGDRLGYHGGHAPTMEIVSVFKGWTTRLRI |
Ga0182189_11254271 | 3300015344 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNEDRLGNQSCHAPTMEIVSVFKRWTTRLRMTSSKCRLEL |
Ga0182189_11639221 | 3300015344 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGCHAPTIEIVSVFKGWMTRLRMTSSKCRLELERHLQ* |
Ga0182189_11808471 | 3300015344 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQGGHAPTMEIVSIFKGWTTRLRMTSSKCRLELERHLE* |
Ga0182189_12275891 | 3300015344 | Miscanthus Phyllosphere | MTNVCFVEVIKLGHGNGDQLGNQGGHAPTMEIVSVFKGWTIRLRMTSSKCRLELERHLE* |
Ga0182189_12295152 | 3300015344 | Miscanthus Phyllosphere | IELGHDNGDRLGNHECHAPTMEIVLGFKGWTTRLRMN* |
Ga0182189_12300051 | 3300015344 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQGGHVPTMEIVSVFKGWT |
Ga0182111_10316911 | 3300015345 | Miscanthus Phyllosphere | MTNVCFTDAIKLGHGNGN*LGNHGCHAPTMEIILV |
Ga0182111_10877371 | 3300015345 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLSNRGGHAPMMEIVSVFKGWTTRLRMTSSKCRLELE* |
Ga0182111_11049321 | 3300015345 | Miscanthus Phyllosphere | MTNVCFTEAIKLGHGNGDRLGNHGCHAPTMEIVSVFKGWTT |
Ga0182111_11140201 | 3300015345 | Miscanthus Phyllosphere | MITVTNVCFVEAIKLGHGNGDRLGNQGGHAPTMEIVSVL |
Ga0182111_11219171 | 3300015345 | Miscanthus Phyllosphere | VTNMCFAEAIKLGHDNGDQLGNQGSHAHKVEIISVFKGWTTRLRMTSSKCRLVLKSHLE* |
Ga0182111_11235041 | 3300015345 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDRLVYHGGHAPTMEIILVFKGWTAR |
Ga0182111_11436241 | 3300015345 | Miscanthus Phyllosphere | MITVTNVCFAEAIKLGHGNGDRLGNQGGHAPTMEIVLVFK |
Ga0182111_12050241 | 3300015345 | Miscanthus Phyllosphere | MTNVCFAETIKLGHGNGDRLGNRGGHAPTMEIVSVFKGWTTRL |
Ga0182139_10846322 | 3300015346 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDQLGNQGGHAPTMEISSVFKGWTTRLRMTSSKCRLE |
Ga0182139_10883141 | 3300015346 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLANHGCHAPTMEIVLVFKGWTTRLRMTSSKYRLELKRHLE* |
Ga0182139_10929721 | 3300015346 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQGGHASMMEIVSVFKGWTTRLRMD* |
Ga0182139_11200281 | 3300015346 | Miscanthus Phyllosphere | CVLQRQIKLGHGNGDRLGNHECHGPTMEIVSVFKGWTTMLRMTSSKCRLMLKTHL* |
Ga0182139_11341681 | 3300015346 | Miscanthus Phyllosphere | MTNVCFAEANKLGHGNGDRLGDHGCHAPTMEIILVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0182139_11363621 | 3300015346 | Miscanthus Phyllosphere | MTNVCFAEVIKLGHGNGNYLGNHGCHAPTMEIVSVFKGWTTRLRMD* |
Ga0182139_11605691 | 3300015346 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQGYHAPTMEIVSVFKGRTTRLRITSSKCQLELERH |
Ga0182139_11776972 | 3300015346 | Miscanthus Phyllosphere | VITVTNVCFTDAIKLGHGNGNGLGNHGCHAPTMEIVSVFKGWTTRLR |
Ga0182139_12322021 | 3300015346 | Miscanthus Phyllosphere | MITVTNVCFAKAIKLGHGNGDRLGYHGGHAPTMEIVSVFKGW |
Ga0182177_10403142 | 3300015347 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNRDGHAPTMEIISVF |
Ga0182177_10427481 | 3300015347 | Miscanthus Phyllosphere | MTNVCFAEAIKLRHGNGDRLGNRGYHAPTMEIVSVFKGRTT |
Ga0182177_11201651 | 3300015347 | Miscanthus Phyllosphere | MIIMTNECFAEAIKLGHGNGEQLGKPGYHAPTMEIISVLKGRTTRLRITSSKCQLKLERHLE* |
Ga0182177_11228571 | 3300015347 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGYHGGHVPTMEIVSVFKGWTSSKCRL |
Ga0182177_11294171 | 3300015347 | Miscanthus Phyllosphere | MTNVCSAEAIKLGHGNGDRLGNQGGHAPTMKIVSVFKGWTTRLRMTSSKCRLELE* |
Ga0182177_11309091 | 3300015347 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGGHAPTMEIISVFKGWTTR |
Ga0182177_11342251 | 3300015347 | Miscanthus Phyllosphere | MTNVCFVEANKLGHGNGDQLGNQGCHAATMEIILVFKGWTTRLRMTS |
Ga0182177_11630471 | 3300015347 | Miscanthus Phyllosphere | TMTKGCFANAIKLGHGNGDLFGNRCSNAPTMEIVLIFKGWTTRLKTD* |
Ga0182177_11669161 | 3300015347 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGYHGGHAPTMEIVSVSKG |
Ga0182177_11746911 | 3300015347 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNRDRLGNHGGHAPTMEIISVFKGWMIRLRTD* |
Ga0182177_12223721 | 3300015347 | Miscanthus Phyllosphere | VCFAEAIKLGHGNGDRLGNHGCHAPTMEIVSVFKGWVTRLRMD* |
Ga0182177_12255361 | 3300015347 | Miscanthus Phyllosphere | MTNVCFVGAIKLGHGNGKRSSNQSCHAPTMEIVSVFKG |
Ga0182177_12417481 | 3300015347 | Miscanthus Phyllosphere | MCFAETIKLGHGNGDQLGNQGGHAPTMEIILVFKGWTTRLRMTSSKYRLELERHLE* |
Ga0182161_10067471 | 3300015351 | Miscanthus Phyllosphere | MITMTNVCFAEAIKLGHGNGDRLGNHGGHAPTMEIVSVFK |
Ga0182161_10278441 | 3300015351 | Miscanthus Phyllosphere | MTNVCFADAIKLGHGNGDQLGNQGCHAATMEIILVFKGWTTRLRMT |
Ga0182161_10473321 | 3300015351 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDQLGNQGGHAPTMEIISVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0182161_10512711 | 3300015351 | Miscanthus Phyllosphere | MTNVCFVEANKLGHGNGDQLGNQGCHAPTMEIVSVFKGWTTR |
Ga0182161_10685421 | 3300015351 | Miscanthus Phyllosphere | VITVTNVCFAETIKLGHGNGDRLGNQGGHAPMMEIVSVF |
Ga0182161_10697941 | 3300015351 | Miscanthus Phyllosphere | MTNTCFVEAIKLGHGNGDRLGNQGGHAPTMEIISVFKGWTTRLRM |
Ga0182161_10822381 | 3300015351 | Miscanthus Phyllosphere | MTKVCFVEAIKLGHGNGDQLGNHGGHAPTMEIISVFKGWTTRLRMD* |
Ga0182161_10929361 | 3300015351 | Miscanthus Phyllosphere | MTNVCFEEAIKLGHGNGDRLGNHGCHTPTMEIVSVFKGWTTRLRMTSSKCRLE |
Ga0182161_11130241 | 3300015351 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNHGCHAPTMEIVSVFKGWMIR |
Ga0182161_11278391 | 3300015351 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHDNGDRLGYHGGHATTMKIVSVFKGW |
Ga0182161_11339722 | 3300015351 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNRDLLGNHGGHAPTMEIVLVFKGWT |
Ga0182161_11713661 | 3300015351 | Miscanthus Phyllosphere | MINAYFAEAIKLGHDNGDRLDNRGGHALTMEIVLVFKGWTT |
Ga0182161_11849931 | 3300015351 | Miscanthus Phyllosphere | MITMTNVCFAEAIKLGHGNGDRLGYHCGHAPTMEIISVFKGWMTRLRM |
Ga0182161_12388731 | 3300015351 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGYHATTMEIVSVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0182161_12503211 | 3300015351 | Miscanthus Phyllosphere | MTKVCFVDTIKLGHGNGDQSGNQSCHAPTMEIVSVFKGWTTRLRMTSSKCRL |
Ga0182159_10044682 | 3300015355 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGYHGGHAPMMEIVLVFKGWM |
Ga0182159_10548811 | 3300015355 | Miscanthus Phyllosphere | MITMTNVCFAEAIKLGHGNGDRLGNRVGHAPMMEIASVFKGLTTR |
Ga0182159_11081781 | 3300015355 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHDKGN*LGNHGCHAPTMEIVSVFK |
Ga0182159_11141661 | 3300015355 | Miscanthus Phyllosphere | MTNVCFAETIKLGRGNGDQLGYHGGHAPTMEIVLVFKGWTTRLRMD |
Ga0182159_11453551 | 3300015355 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDRLVYHGGHAPTMEIILVFKGWTARLRMD* |
Ga0182159_11474941 | 3300015355 | Miscanthus Phyllosphere | VITVTNVCFAKAIKLGHGNGDRLGYHGGHAPTMEIVLVFKG* |
Ga0182159_11525221 | 3300015355 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLSNLVCHAPTMEIVSVFKGWTTRLRITSSKCQLKLERHLE* |
Ga0182159_11659092 | 3300015355 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGNHGCHAPMMEIISIF |
Ga0182159_11754591 | 3300015355 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNRDGHAPTMEIISVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0182159_11904131 | 3300015355 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLDNHGGHVHTMEIVSVFKGWTTRLRMD* |
Ga0182159_11954741 | 3300015355 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHSNGDRLGYHYGHAPTMEIISVFKG |
Ga0182159_12189821 | 3300015355 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGNHGGHAPTMEIVSVFKGWTTRLRMD |
Ga0182159_12283161 | 3300015355 | Miscanthus Phyllosphere | MTNVCFVEANKLGHGNGDQLGNQGCHAPTMEIVSVFKGWTTRLRMTSSKCRLELE |
Ga0182159_12545401 | 3300015355 | Miscanthus Phyllosphere | VVTVTNVCFVEAIKLGHGNGDRLGNHGGHAPTMEIISVFKGWTTRLMID* |
Ga0182159_12575701 | 3300015355 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDLLGKQGCHAPTMEIISVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0182159_13020281 | 3300015355 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDPLGNRGCHAPTMEIVSVFKGWTTR |
Ga0182159_13259651 | 3300015355 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNEERLGNQSCHTPSMEIVSVFKGWTTRLRMISSKCRL |
Ga0182159_13486441 | 3300015355 | Miscanthus Phyllosphere | VTNVCFAEATKLGHGNRDRLGNHGCHAPTMEIVSVFKGWTT |
Ga0182145_10020041 | 3300015361 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNHGGHAPTMEIVSVF |
Ga0182145_10124342 | 3300015361 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQGGHASTMEIISVFKGWTTRL |
Ga0182145_10329212 | 3300015361 | Miscanthus Phyllosphere | MITMTNVCFAESIKLGHGNGDRLGNHGGHTPTMEI |
Ga0182145_10535551 | 3300015361 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHCNGDRLGNQGGHAPTMEINLVFKGW |
Ga0182145_10754761 | 3300015361 | Miscanthus Phyllosphere | MTNVCFEEAIKLRHGNGDQLGNQGCHAPTMEIVSIFKGWTTRLRMTSSK |
Ga0182145_10877501 | 3300015361 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHANGDRLGNRSGHTPTLEIILVFKGWTTM |
Ga0182145_10897581 | 3300015361 | Miscanthus Phyllosphere | YKITMTNVCFAEAIKLDHGNGDRLGNHGCHAPTMEIVSVFKGWTPRLRMD* |
Ga0182145_11046241 | 3300015361 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDRLGYHGGHAPTMEIVSVFKAWTTRLRMD* |
Ga0182145_11049151 | 3300015361 | Miscanthus Phyllosphere | MTNVYFAEAIKLGHGNRDQLGNRGGHAPTMEIVSVFKGWTTRLRMTS |
Ga0182145_11166901 | 3300015361 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGNNGCHAPTMEIVSVFKGWTTRLRMTSSKCRLELERHLE* |
Ga0182145_11369441 | 3300015361 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGNHGCHAPTMEIVSVF |
Ga0182145_11678151 | 3300015361 | Miscanthus Phyllosphere | NVCFAEAIKLGYGNGDRLGNRGGHAPTMEIISVFKGWTTRLRMTSSKCRLVLKRHLE* |
Ga0182145_11698401 | 3300015361 | Miscanthus Phyllosphere | CFAEAIKLGHGNGDRLGNHGGHAPTMEIVLVFKGWTTRLRMD* |
Ga0182145_11788381 | 3300015361 | Miscanthus Phyllosphere | QYVITMTNVCFAEAIKLGHGNGDRLGNAPMMEIILVFKG* |
Ga0182203_10162181 | 3300017404 | Miscanthus Phyllosphere | MTNVCFAEGIKLGNGNGNRLGYHDIHARTLEIVLVFKGW |
Ga0182203_10539761 | 3300017404 | Miscanthus Phyllosphere | MTNVCFIETIKFGHGNGDRLGNHGGHAPTMEIVSVFKGWTTR |
Ga0182203_10797701 | 3300017404 | Miscanthus Phyllosphere | MTNVCFAKAIKLGHGNGDRLGNHGGHAPTMEIVSVFKG |
Ga0182203_11002411 | 3300017404 | Miscanthus Phyllosphere | FVEAIKLGHGNGDRLGNHGGHAPTMEIILVFKGWTTRLRMD |
Ga0182203_11122581 | 3300017404 | Miscanthus Phyllosphere | MTNLFFTEAIKLGHGNGDQLGNQGGHAPTMEIVSVFK |
Ga0182203_11127951 | 3300017404 | Miscanthus Phyllosphere | MTNVCFTETIKLGHGNGDRLGNRGGHAPTMEIVSVF |
Ga0182203_11327491 | 3300017404 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGSHGGHAPTMEIVLVFKGWMTRLRMTSSKC |
Ga0182220_10613421 | 3300017407 | Miscanthus Phyllosphere | MTNVCFAETIKLGHGNGDQLGNQGGHAPTMEIVSVFKGWTTRLRMTSSKCRLELKRHLE |
Ga0182220_10856291 | 3300017407 | Miscanthus Phyllosphere | QYMITMTNVCFADAIKLGHGNRDRLGYYGGHAPTMEIVSVFKGWTTRLRMD |
Ga0182220_10937231 | 3300017407 | Miscanthus Phyllosphere | MTNVCFAEAIKFGQGNGDRLGNQGGHAPTMKIVSIFKGWTTRLRM |
Ga0182220_10955351 | 3300017407 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGCHAPTMEIVSVFK |
Ga0182204_10127391 | 3300017409 | Miscanthus Phyllosphere | MTNMCFAETIKLGHGNGDRLDNHGCHAPTMKIVSVF |
Ga0182204_10171211 | 3300017409 | Miscanthus Phyllosphere | MTNVCFADTIKLGHGNGDRLGNLSCHAPMMEIVSVFKGWITRLRMTSSKCRLELERHLE |
Ga0182204_10381592 | 3300017409 | Miscanthus Phyllosphere | MTNMCFADAIKLGHGNGDQSGNQSCHAPTMEIISVF |
Ga0182204_10480901 | 3300017409 | Miscanthus Phyllosphere | MTNVCFADAIKLGHGNGDQLGNQGCHAPTMEIISVFKG |
Ga0182204_10771942 | 3300017409 | Miscanthus Phyllosphere | MTNVYFAEAIKLGHGNGDQLGNQGGHAPTMEIISVFKGWTTRLRM |
Ga0182204_10832602 | 3300017409 | Miscanthus Phyllosphere | AEAIKLGHGNGDRLGYHGGHAPTMEIVSVFKGWTTRLRMD |
Ga0182207_10084981 | 3300017410 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQGCHAPTMEIVSVFKG |
Ga0182207_10182171 | 3300017410 | Miscanthus Phyllosphere | MTNVCFADAIKLGHGNGNXLGNHGCHAPTMEIVSVFK |
Ga0182207_10326021 | 3300017410 | Miscanthus Phyllosphere | MTNICFAEAIKLGHGNGNLLGNHGCHAPTMEIVLVFKGWT |
Ga0182207_10857301 | 3300017410 | Miscanthus Phyllosphere | MTNVYFAEAIKLGHGNGNXLGNHGCYAPTMEIISV |
Ga0182207_11018832 | 3300017410 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHGAHAPTMEIVFGFQRMDD |
Ga0182207_11048672 | 3300017410 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQGGHAPTMEIVSVFKGWTTRLRM |
Ga0182207_11668461 | 3300017410 | Miscanthus Phyllosphere | VITMTNMCFAEAIKLGHGNGDRLGYHGGHAPTMEIISVFKG |
Ga0182208_10233301 | 3300017411 | Miscanthus Phyllosphere | MTNMCFAEAIKLDHGNGDRLGYHGGHAPTMEIVLVFK |
Ga0182208_10569641 | 3300017411 | Miscanthus Phyllosphere | VITITNVCFAIAIKLGHGNGDRLGNHGCHAPMMEIVSVFKGWTTRLRMN |
Ga0182208_10591571 | 3300017411 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGDRLGSQGGHAPTMEIVSVFKGWTIRLRMY |
Ga0182208_10761462 | 3300017411 | Miscanthus Phyllosphere | MCFAEAIKLGHDNGDRLGNHDGHAPTMEIILVFKGWTTRLRM |
Ga0182208_11089551 | 3300017411 | Miscanthus Phyllosphere | VITVTNVYFVEAIKLSHGNGDRLGNHGGHAPTMEIVLVFKGWTSSKCRLELK |
Ga0182222_10112141 | 3300017413 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGKGDRLGNRGCHAPTMEIVSVFKGWTTRLRMTSSKCRL |
Ga0182222_10474291 | 3300017413 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGKGDRLGNQSCHAPTMEIVSAFKGWTTRLR |
Ga0182222_10743611 | 3300017413 | Miscanthus Phyllosphere | VITVTNVCFVEAIKLGHGNGDQLGKHGGHAPTMEIVSVFKGWTIRLRMD |
Ga0182222_10751161 | 3300017413 | Miscanthus Phyllosphere | NVCFAEAIKLGHGNGDRLGNQSCHAPTMEIVSVFKEWTTRLRMTSSKCRFQLERHLE |
Ga0182222_11020571 | 3300017413 | Miscanthus Phyllosphere | VIAVTNVCFAEAIKLGHGNGDRLGNRGGHAPTIEIILVFKEWMTRLRTD |
Ga0182222_11062611 | 3300017413 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDRLGSHGGHAPTMEIVSVLKD |
Ga0182202_10226091 | 3300017415 | Miscanthus Phyllosphere | MTNVCFADAIKLGHGNGDRLGNRGGHAPTIEIVSVFKGWTTRLRMTSSKCRLELE |
Ga0182202_10485651 | 3300017415 | Miscanthus Phyllosphere | EAIKLGHGNGDRLGYHGGYAPTMEIVLVFKGWTTRLRMD |
Ga0182202_10660031 | 3300017415 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDQLGNQGGHAPTMEIVSVFKGWTTRLRMTSSKCRLELERHLE |
Ga0182202_10735981 | 3300017415 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIISVFKGWTTRLRMTSSKCRLELERHLE |
Ga0182202_10766371 | 3300017415 | Miscanthus Phyllosphere | MTNVCFVDAIKLGHGNGDQSGNQSCHAPTMEIISVFKGWTTRLRMTSSKCQLELERH |
Ga0182202_10801011 | 3300017415 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNEDQLGNQSCHAPSMEIVSVFKGWTTRLRMTSSKCRLE |
Ga0182202_11106631 | 3300017415 | Miscanthus Phyllosphere | MTNVCFVEANKLGHGNGDQLGNQGCHAPTMEIVSVFKGWTTRLRMTSSKCRLKLE |
Ga0182202_11272081 | 3300017415 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDQLGNRGYHAPTMEIVSVFKGRTTRLRITSSKCQLELER |
Ga0182230_10406092 | 3300017417 | Miscanthus Phyllosphere | MTNMCFAEAIKLGHGNGDRLGNRGCHAPTMEIISVFKGL |
Ga0182230_10740591 | 3300017417 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLSYHGGHAPTMEIVSVFKGWTTR |
Ga0182230_10881422 | 3300017417 | Miscanthus Phyllosphere | ITVTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWTTRLRRD |
Ga0182228_10560151 | 3300017420 | Miscanthus Phyllosphere | MTNVCFAHAIKLGHGNGDQSGNPSCHAPTMEIISVFKGWT |
Ga0182228_10704191 | 3300017420 | Miscanthus Phyllosphere | MITVTNVCFAEAIKLGHNNGDRLGYHGGHAPTMEIVSIFKGWT |
Ga0182228_10893001 | 3300017420 | Miscanthus Phyllosphere | MTNVYFVEAIKLGHGNKDQLGNHGGHASTMEIVLVFKVWT |
Ga0182219_10365611 | 3300017424 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWMTRLRMTSSKCRLELERHL |
Ga0182219_10424282 | 3300017424 | Miscanthus Phyllosphere | MTNVCFVETIKLGHGNGDRLGYHVCHAPTMEIILVFKRWTTR |
Ga0182219_11263731 | 3300017424 | Miscanthus Phyllosphere | MTNVCFTEAIKLGHSNGDQLGNYGGHAPTMEIISVFKGW |
Ga0182219_11298851 | 3300017424 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDRLGNHGGHAPTMEIVLVFKGWTTRLRMD |
Ga0182224_10055541 | 3300017425 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNQGGHAPNMEIVSIFKG |
Ga0182224_10082093 | 3300017425 | Miscanthus Phyllosphere | MTNVCFAEAIKLGRGNGDQLGNYGGYAPTMEIVSVFKGWTTRLMMD |
Ga0182224_10402943 | 3300017425 | Miscanthus Phyllosphere | MSNVCFAEAIKLGHGNGDRLGNQGSHAPTMEIVSVFK |
Ga0182224_10488031 | 3300017425 | Miscanthus Phyllosphere | MITMTNVCFVEVIKLGHGNRDRLGNQGGHAPTMEIVSVFKEWTTRLRID |
Ga0182224_10622141 | 3300017425 | Miscanthus Phyllosphere | MITVTNVCFADAIKLGHGNGNRLGNHGCHAPMMEIIS |
Ga0182224_10789861 | 3300017425 | Miscanthus Phyllosphere | MCFVEAIKLGHGNGDRLGYHGGHAPTMEIVSVFKGWTTMLRMD |
Ga0182224_10948681 | 3300017425 | Miscanthus Phyllosphere | MTNVCFAEAINLGHGNNNXLGNHGCHAPTMEIVLVFKGWT |
Ga0182224_11004161 | 3300017425 | Miscanthus Phyllosphere | SVDCRASFVETMTNMRFAEAIKLGHGNGDRLGNHGGHAPMMEIISVFNGWTTRLRMD |
Ga0182224_11260171 | 3300017425 | Miscanthus Phyllosphere | MTNMCFAETIELGHCNGDRLGNHGRHAPMMEIVSVFKGWM |
Ga0182224_11473771 | 3300017425 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDQLGNQGGHAPTMEIVLVFKGWT |
Ga0182190_10403021 | 3300017427 | Miscanthus Phyllosphere | VITVTNVCFVEAIKLGHDNGDRLGYHGGHAPTKEIISVF |
Ga0182190_10458761 | 3300017427 | Miscanthus Phyllosphere | MTNVFFAETIKLGYGNGDRLGYHGGHAPTMEIVSVFKXWTTRLRM |
Ga0182190_10648401 | 3300017427 | Miscanthus Phyllosphere | MTNMCFAEAIKLGHGNGDRLGNHGYHATTMEIVSIFKGWTTGLRMTSSKCRLELERHLE |
Ga0182192_10234481 | 3300017430 | Miscanthus Phyllosphere | MTNMCFAEAIKLGYGNGNXLGNHGCHAPTMEIVLVFKGW |
Ga0182192_10554471 | 3300017430 | Miscanthus Phyllosphere | MSNVCFAEAIKLGHDNEDRLGNQGGHASTMEIISVFK |
Ga0182192_10907571 | 3300017430 | Miscanthus Phyllosphere | MTNVCFVEANKLGHGNGDQLGNQGCHAPTMEIVSVFKGWT |
Ga0182192_11101452 | 3300017430 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNRDRLGNHGCHAPTMEIVSVFKGWTTRLRMD |
Ga0182192_11223051 | 3300017430 | Miscanthus Phyllosphere | MTNVWFAEAIKLGHGNGDRLGNHGYHATTMEIVSVFKG |
Ga0182192_11371973 | 3300017430 | Miscanthus Phyllosphere | MITVTNVCFAETIKLGYGNGDQLGNYGCHAPMIEIILVF |
Ga0182192_11698761 | 3300017430 | Miscanthus Phyllosphere | VITVTNVCFIEAIKLGHGNGDRLGYHGGHAPTMEIVSVFKGWMARLRMD |
Ga0182206_11422522 | 3300017433 | Miscanthus Phyllosphere | MTNVCFAEANKLGHGNGDQLGNQGCHAPTMEIILVFKGWTT |
Ga0182194_10328601 | 3300017435 | Switchgrass Phyllosphere | MTNVCFVEAIKLGHSKGDQLGNQGGHAPMMEIVSVFKGWTTRLRMD |
Ga0182209_10114441 | 3300017436 | Miscanthus Phyllosphere | MTNVYFAEAIKLGHSNGNXLGNHGCLAPMMEIILVF |
Ga0182209_10412031 | 3300017436 | Miscanthus Phyllosphere | MTNVCFAEAIELGHGSGDRLGNRGCHAPTMEIVSVFKGWTTRLR |
Ga0182209_10475901 | 3300017436 | Miscanthus Phyllosphere | MTNVCFAKTIKLGHGNGDRLGNHGGHAPMMEIVSV |
Ga0182209_10503971 | 3300017436 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLSNRGGHAPMMEIVSVFEGWTTRLRMTSSKCRLELE |
Ga0182209_10557171 | 3300017436 | Miscanthus Phyllosphere | MTNVCFAEAIKLGYGNGDRLDNHGCHAPTMEIVLVFKGWTTRLRMTSSKCRLELERHLE |
Ga0182209_10571891 | 3300017436 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGNLLGNYGCHASTMEIVSVFKGWMTRLR |
Ga0182209_10581361 | 3300017436 | Miscanthus Phyllosphere | MTNVCFAEAIKLGSGNGDQLGNYGGYAPTMEIVSVFKGWTTRLMMD |
Ga0182209_10807291 | 3300017436 | Miscanthus Phyllosphere | CFTEAIKSGHGNGDPLGYHGGHAPTMEIISVFKGCTTRLRMD |
Ga0182209_11535191 | 3300017436 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNRDRLGNHGCHAPTMEIVSVFKGWTTRLRM |
Ga0182209_11621381 | 3300017436 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNHDGHAPTMEIVLVFKEWTKRLRMD |
Ga0182191_10343841 | 3300017438 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGNXLGNHGCHAPTMEIILVF |
Ga0182191_10504692 | 3300017438 | Miscanthus Phyllosphere | VTNVCFAEAIKLGYGNGDRLDNHSCHAPTMEIVLVFKGWTTRLRMTSSKC |
Ga0182191_10706801 | 3300017438 | Miscanthus Phyllosphere | MTNVYFAETIKLGHSNGDRMGNQGCHAPTMEIVSVFKG |
Ga0182191_10783012 | 3300017438 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGYHGGHATTMEIVSVFKGWTT |
Ga0182191_10891722 | 3300017438 | Miscanthus Phyllosphere | MTNVCFTEAIKLGHGNGDRLGNEGGHAPTMEIVSVFKGWTIRL |
Ga0182191_11158261 | 3300017438 | Miscanthus Phyllosphere | MTNVCFAEAVKLDHGNGDRLGNQGGHAPTMEIILVSTDGQQG |
Ga0182191_11567671 | 3300017438 | Miscanthus Phyllosphere | VCFADAIKLGHGNGDQSGNQSCHAPTMEIVSVFKGWTTRLRMTSSKCRLELERHLE |
Ga0182191_11751021 | 3300017438 | Miscanthus Phyllosphere | MTNVCFVEASKLGHGNGDQLGNQSCHAPTMEIVSVFKGWTTRLRMTSSKC |
Ga0182191_11787101 | 3300017438 | Miscanthus Phyllosphere | VITVTNVCFAEAIKLGHGNGDRLGNHGCHDPTMEIVSVFKGWTTR |
Ga0182191_11788251 | 3300017438 | Miscanthus Phyllosphere | TMTNVCFAEAIKLGHGNGDRLGYHGGHAPTMEIVLVFKG |
Ga0182221_10323521 | 3300017442 | Miscanthus Phyllosphere | LGHGNGDQLGNQGCHAPTMEIVLVFKGWTTRLRMD |
Ga0182221_10387401 | 3300017442 | Miscanthus Phyllosphere | MTNVCFVEAIKLGHGNGNXLGNHGCHAPTMEIVSV |
Ga0182221_10969401 | 3300017442 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNRGGHAPTMEIISVFKGWTTRLRMTSSKCRLELE |
Ga0182221_11017231 | 3300017442 | Miscanthus Phyllosphere | MTNMCFAEAIKLGYSNGDRLGYRGGHAPMIEIISVFKGW |
Ga0182221_11107711 | 3300017442 | Miscanthus Phyllosphere | MTNMCFAEAIKLGYGNGDRLGNRGGHDPMMEIVSVFQGWTTRLT |
Ga0182221_11263051 | 3300017442 | Miscanthus Phyllosphere | MTNVCFVEVIKLGHGNGDRLGYHGGHAPTMEIVSVFKGWT |
Ga0182193_10078601 | 3300017443 | Miscanthus Phyllosphere | MTNMCFAETIKLGHGNGDRLGNNGCHAPTMEIVSVFKGWTTRLRMTSSKCRLELERH |
Ga0182193_10537931 | 3300017443 | Miscanthus Phyllosphere | MITVTNVCFVEAIKLGHGNEDRLGYHGGHVPTMEIILVFKGWTTRLRMD |
Ga0182193_10888311 | 3300017443 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHDNDNXLGNHGCHAPMMEIILVFKG |
Ga0182193_11027321 | 3300017443 | Miscanthus Phyllosphere | MITVTNVCFAKAIKLGHGNGDRLGYHGGHAPMMEIVSVFKGWTSSKCR |
Ga0182193_11365241 | 3300017443 | Miscanthus Phyllosphere | MTNVCFADAIKLGHGNGDQSGNQSCHAPTMEIVSVFKGWTTRLRMTSSKCRL |
Ga0182193_11433511 | 3300017443 | Miscanthus Phyllosphere | MTNVCFAETIKLGHGNGDRLGNRGGHAPTMEIVSV |
Ga0182193_11870451 | 3300017443 | Miscanthus Phyllosphere | MSFAEAIKLGHGNGDQLGNQGGHAPMMEIILVFKGWTTRLRMTSSKCRL |
Ga0182193_11919191 | 3300017443 | Miscanthus Phyllosphere | MTNVCFVEAIKLDHGNEDRLGNHGGHAPMMEIVSVFKGWTTRLRMD |
Ga0182193_11996791 | 3300017443 | Miscanthus Phyllosphere | MTKVCFVDTIKLGHGNGDQSGNQSCHAPTMEIVSVF |
Ga0182233_10414541 | 3300017680 | Miscanthus Phyllosphere | MCFAEAIKLGHGNGDRLGNQGCHAPTMEIVSVFKGWTT |
Ga0182226_10597611 | 3300017681 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGNNGCHAPTMEIILV |
Ga0182229_10941831 | 3300017682 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNKDRLGNRGCHAPTMEIVSVFKGWT |
Ga0182218_10106111 | 3300017683 | Miscanthus Phyllosphere | MTNVCFADAIKLGHGNGDRLGNHGGHAPTMEIVSVF |
Ga0182218_10232872 | 3300017683 | Miscanthus Phyllosphere | MTNVCFAEKSKLGHGNGDQLDNQGCHAPTMEIVSVFKGWTTRLRMNSSKCRLELERHLE |
Ga0182225_10398191 | 3300017684 | Miscanthus Phyllosphere | MTNMCFVEIIKLGHGNGDRLGNHGGHAPTMEIVSVFEGWTTRLRMD |
Ga0182225_10565341 | 3300017684 | Miscanthus Phyllosphere | QYMITMTNVCFTEAIKLGHGNGDRLGNQGGHAPMMEIILVFKGWTTRLRTN |
Ga0182225_10596211 | 3300017684 | Miscanthus Phyllosphere | MTNVCFGEANMLGHGNGDRLGNRGGHAPTMEIISVFKGWMTRLRMTSSKCRLELERHLE |
Ga0182225_11295962 | 3300017684 | Miscanthus Phyllosphere | MTNVCFTETIKLGHSNGDQLGNYGGHAPTMEIISVF |
Ga0182227_10291641 | 3300017685 | Miscanthus Phyllosphere | MSNVCFAEAIKLGHTNGDQLGIQGGHAPTMEIVSVFKGWTTRLRMTSSK |
Ga0182227_10607231 | 3300017685 | Miscanthus Phyllosphere | VTNVCFAEAIKLGYGNGDRLGNRGCHAPMMKIVLVFKGWTI |
Ga0182227_10960821 | 3300017685 | Miscanthus Phyllosphere | MTNVCFEETIKLGHGNGDRLGNHVGHAPTMEIVSIFKGWTTMLMMD |
Ga0182227_10993271 | 3300017685 | Miscanthus Phyllosphere | MCFAEAIKLGHGNGNRLGNYGGHAYTMEIVSVFKGWTTR |
Ga0182227_11123191 | 3300017685 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDQLGNRGGHAPTMEIILVFKGWMTKLRM |
Ga0182205_10329881 | 3300017686 | Miscanthus Phyllosphere | VITVTNVCFTEVITLGHGNGDRLGNHGGHAPTIEIVSVFKRWTTRLRMD |
Ga0182205_10527521 | 3300017686 | Miscanthus Phyllosphere | MINVCFAEAIKLGHGNGEQLGNGDGHAPTIEIVSVFKGWTTRLRMTSSK |
Ga0182205_11007081 | 3300017686 | Miscanthus Phyllosphere | MTNVYFAEAIKLGHGNGDRLGNRRCHAPTMEIVSVFKGWTTRLRMTSSKC |
Ga0182205_11497081 | 3300017686 | Miscanthus Phyllosphere | MTNVCFAEAIKLSHGNGDRLGNHGCHAPMMEIVSVFKGWTTRLRMTSSKCRLELERH |
Ga0182205_11713431 | 3300017686 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDQLGNHGCHAPTMEIVSVFKGWTTRLR |
Ga0182223_10188222 | 3300017690 | Miscanthus Phyllosphere | VTNVCFAEAIKLGHGNGDRLGNQGGHAPTMEIVLVFKGW |
Ga0182223_11025251 | 3300017690 | Miscanthus Phyllosphere | MTNVCFAEAIKLAHGNGDQLGNQGGHAPTMEIVLVFKGWMTRLRMTSSKCRLELER |
Ga0182223_11047441 | 3300017690 | Miscanthus Phyllosphere | VCFAEAIKLGHANGDRLGNQGGHAPTMEIISVFKGWMTRLRMTSSKCRLELE |
Ga0182223_11050391 | 3300017690 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDRLGYHGGHAPTMEIILVFKV |
Ga0182223_11246451 | 3300017690 | Miscanthus Phyllosphere | MTNVCFAEAIKLGHGNGDQLGYHGGHAPTMEIISVFKGWTRLK |
Ga0182232_10844161 | 3300021060 | Phyllosphere | MTNVCFADAIKLGHGNGDQLGNQGCHAPTMEIVSVFKGWTTRLRM |
Ga0207688_100303442 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNVCFAEAIKLGHGNGDRLGNRGCHAPTMEIVSVFKGWTTRLRMTSSKCRLELERHLE |
⦗Top⦘ |