Basic Information | |
---|---|
Family ID | F004323 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 443 |
Average Sequence Length | 42 residues |
Representative Sequence | MPLNGLRRLEGRATPAAANHSPVTRDYPSRALSDVFQAAALRL |
Number of Associated Samples | 296 |
Number of Associated Scaffolds | 443 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.64 % |
% of genes near scaffold ends (potentially truncated) | 98.65 % |
% of genes from short scaffolds (< 2000 bps) | 99.55 % |
Associated GOLD sequencing projects | 295 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.269 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (14.673 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.445 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (34.086 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.27 % |
Unclassified | root | N/A | 32.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2209111013|DRAFT_Contig_82665 | Not Available | 549 | Open in IMG/M |
3300001199|J055_10133110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 944 | Open in IMG/M |
3300001448|JGI20219J14954_1005790 | Not Available | 729 | Open in IMG/M |
3300002658|Ga0005478J37266_104563 | Not Available | 800 | Open in IMG/M |
3300003710|Ga0008089_102928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 787 | Open in IMG/M |
3300004577|Ga0066502_160530 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 664 | Open in IMG/M |
3300004585|Ga0066500_117703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
3300004622|Ga0058865_1052188 | Not Available | 547 | Open in IMG/M |
3300004624|Ga0058864_1046801 | Not Available | 559 | Open in IMG/M |
3300004785|Ga0058858_1017214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 768 | Open in IMG/M |
3300004785|Ga0058858_1027394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 704 | Open in IMG/M |
3300004795|Ga0007756_10060001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 780 | Open in IMG/M |
3300004798|Ga0058859_10054273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 521 | Open in IMG/M |
3300004798|Ga0058859_10089185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 545 | Open in IMG/M |
3300004798|Ga0058859_10090261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 511 | Open in IMG/M |
3300004798|Ga0058859_10125805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 678 | Open in IMG/M |
3300004798|Ga0058859_10144571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 512 | Open in IMG/M |
3300004798|Ga0058859_10147830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 711 | Open in IMG/M |
3300004801|Ga0058860_10096190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 741 | Open in IMG/M |
3300004801|Ga0058860_10225088 | Not Available | 590 | Open in IMG/M |
3300004801|Ga0058860_10233830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 676 | Open in IMG/M |
3300005330|Ga0070690_100716488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 770 | Open in IMG/M |
3300005468|Ga0070707_100509929 | Not Available | 1165 | Open in IMG/M |
3300005805|Ga0079957_1241070 | Not Available | 845 | Open in IMG/M |
3300006372|Ga0075489_1298141 | Not Available | 501 | Open in IMG/M |
3300006378|Ga0075498_1015622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 513 | Open in IMG/M |
3300006378|Ga0075498_1089344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300006934|Ga0080680_1023161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 786 | Open in IMG/M |
3300007219|Ga0075025_1030112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 607 | Open in IMG/M |
3300007219|Ga0075025_1055403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 657 | Open in IMG/M |
3300007323|Ga0099768_1113247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 561 | Open in IMG/M |
3300008884|Ga0103746_10018348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 829 | Open in IMG/M |
3300009206|Ga0103750_1016245 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 828 | Open in IMG/M |
3300009225|Ga0103851_1041115 | Not Available | 758 | Open in IMG/M |
3300009230|Ga0103855_10041757 | Not Available | 823 | Open in IMG/M |
3300009230|Ga0103855_10060533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 705 | Open in IMG/M |
3300009230|Ga0103855_10116574 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 534 | Open in IMG/M |
3300009233|Ga0103856_10047970 | Not Available | 757 | Open in IMG/M |
3300009233|Ga0103856_10051537 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 734 | Open in IMG/M |
3300009233|Ga0103856_10052202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 729 | Open in IMG/M |
3300009235|Ga0103857_10028821 | Not Available | 995 | Open in IMG/M |
3300009235|Ga0103857_10029045 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 992 | Open in IMG/M |
3300009235|Ga0103857_10062242 | Not Available | 722 | Open in IMG/M |
3300009235|Ga0103857_10069615 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 688 | Open in IMG/M |
3300009239|Ga0103858_10097993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 731 | Open in IMG/M |
3300009239|Ga0103858_10099233 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 726 | Open in IMG/M |
3300009239|Ga0103858_10107777 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 700 | Open in IMG/M |
3300009239|Ga0103858_10108056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 699 | Open in IMG/M |
3300009243|Ga0103860_10047189 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 848 | Open in IMG/M |
3300009243|Ga0103860_10047195 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 848 | Open in IMG/M |
3300009243|Ga0103860_10048371 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 840 | Open in IMG/M |
3300009247|Ga0103861_10023969 | Not Available | 847 | Open in IMG/M |
3300009247|Ga0103861_10024458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 841 | Open in IMG/M |
3300009247|Ga0103861_10054614 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 624 | Open in IMG/M |
3300009249|Ga0103862_1035396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 673 | Open in IMG/M |
3300009252|Ga0103863_10017007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 847 | Open in IMG/M |
3300009252|Ga0103863_10046853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 598 | Open in IMG/M |
3300009254|Ga0103867_1011715 | Not Available | 831 | Open in IMG/M |
3300009257|Ga0103869_10107512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 702 | Open in IMG/M |
3300009257|Ga0103869_10108673 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 699 | Open in IMG/M |
3300009261|Ga0103870_1016420 | Not Available | 849 | Open in IMG/M |
3300009337|Ga0103864_1002432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 846 | Open in IMG/M |
3300009352|Ga0103865_1003387 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 844 | Open in IMG/M |
3300009579|Ga0115599_1041272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 807 | Open in IMG/M |
3300009579|Ga0115599_1057549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 557 | Open in IMG/M |
3300009579|Ga0115599_1063502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 530 | Open in IMG/M |
3300009580|Ga0115596_1013073 | Not Available | 508 | Open in IMG/M |
3300009580|Ga0115596_1071080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 522 | Open in IMG/M |
3300009580|Ga0115596_1107202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 549 | Open in IMG/M |
3300009580|Ga0115596_1155059 | Not Available | 567 | Open in IMG/M |
3300009581|Ga0115600_1032476 | Not Available | 577 | Open in IMG/M |
3300009581|Ga0115600_1033874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 535 | Open in IMG/M |
3300009582|Ga0115601_1005212 | Not Available | 797 | Open in IMG/M |
3300009582|Ga0115601_1143812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 572 | Open in IMG/M |
3300009583|Ga0115598_1029040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 661 | Open in IMG/M |
3300009583|Ga0115598_1043687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 500 | Open in IMG/M |
3300009584|Ga0115597_1159330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 539 | Open in IMG/M |
3300009586|Ga0115591_1029570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 509 | Open in IMG/M |
3300009586|Ga0115591_1031935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 662 | Open in IMG/M |
3300009586|Ga0115591_1037591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 568 | Open in IMG/M |
3300009587|Ga0115602_1012078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 745 | Open in IMG/M |
3300009587|Ga0115602_1063635 | Not Available | 789 | Open in IMG/M |
3300009587|Ga0115602_1145323 | Not Available | 509 | Open in IMG/M |
3300009755|Ga0115592_1039229 | Not Available | 741 | Open in IMG/M |
3300009755|Ga0115592_1076396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 552 | Open in IMG/M |
3300009755|Ga0115592_1122309 | Not Available | 506 | Open in IMG/M |
3300009755|Ga0115592_1144347 | Not Available | 575 | Open in IMG/M |
3300009755|Ga0115592_1156137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 679 | Open in IMG/M |
3300009755|Ga0115592_1166157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 664 | Open in IMG/M |
3300010061|Ga0127462_173337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 538 | Open in IMG/M |
3300010065|Ga0127435_141214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 779 | Open in IMG/M |
3300010071|Ga0127477_111151 | Not Available | 623 | Open in IMG/M |
3300010078|Ga0127487_105648 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 656 | Open in IMG/M |
3300010078|Ga0127487_160677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 670 | Open in IMG/M |
3300010079|Ga0127436_133052 | Not Available | 808 | Open in IMG/M |
3300010080|Ga0127448_102141 | Not Available | 506 | Open in IMG/M |
3300010084|Ga0127461_1092157 | Not Available | 610 | Open in IMG/M |
3300010091|Ga0127485_1005310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 705 | Open in IMG/M |
3300010096|Ga0127473_1023457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 530 | Open in IMG/M |
3300010103|Ga0127500_1061349 | Not Available | 766 | Open in IMG/M |
3300010109|Ga0127497_1023150 | Not Available | 503 | Open in IMG/M |
3300010111|Ga0127491_1052815 | Not Available | 567 | Open in IMG/M |
3300010114|Ga0127460_1091249 | Not Available | 726 | Open in IMG/M |
3300010116|Ga0127466_1029289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 658 | Open in IMG/M |
3300010117|Ga0127449_1056299 | Not Available | 601 | Open in IMG/M |
3300010117|Ga0127449_1118807 | Not Available | 578 | Open in IMG/M |
3300010122|Ga0127488_1130159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 634 | Open in IMG/M |
3300010124|Ga0127498_1170423 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 744 | Open in IMG/M |
3300010128|Ga0127486_1043519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 669 | Open in IMG/M |
3300010131|Ga0115594_1013606 | Not Available | 575 | Open in IMG/M |
3300010133|Ga0127459_1000345 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 603 | Open in IMG/M |
3300010136|Ga0127447_1125046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 672 | Open in IMG/M |
3300010137|Ga0126323_1149817 | Not Available | 572 | Open in IMG/M |
3300010138|Ga0115595_1045800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 700 | Open in IMG/M |
3300010138|Ga0115595_1056677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 701 | Open in IMG/M |
3300010138|Ga0115595_1155821 | Not Available | 709 | Open in IMG/M |
3300010141|Ga0127499_1018791 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 579 | Open in IMG/M |
3300010144|Ga0115593_1221964 | Not Available | 783 | Open in IMG/M |
3300010144|Ga0115593_1346247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 738 | Open in IMG/M |
3300010144|Ga0115593_1348923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 662 | Open in IMG/M |
3300010144|Ga0115593_1351297 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 593 | Open in IMG/M |
3300010144|Ga0115593_1352019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 546 | Open in IMG/M |
3300010144|Ga0115593_1384129 | Not Available | 572 | Open in IMG/M |
3300010145|Ga0126321_1181565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 508 | Open in IMG/M |
3300010145|Ga0126321_1309998 | Not Available | 728 | Open in IMG/M |
3300010147|Ga0126319_1035450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 812 | Open in IMG/M |
3300010857|Ga0126354_1255108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 661 | Open in IMG/M |
3300010896|Ga0138111_1121115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 653 | Open in IMG/M |
3300011120|Ga0150983_13593761 | Not Available | 519 | Open in IMG/M |
3300011282|Ga0138293_135249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 781 | Open in IMG/M |
3300011332|Ga0126317_10998109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 511 | Open in IMG/M |
3300011333|Ga0127502_10026927 | Not Available | 577 | Open in IMG/M |
3300011340|Ga0151652_10430165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 671 | Open in IMG/M |
3300011340|Ga0151652_10815390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 655 | Open in IMG/M |
3300011340|Ga0151652_12593704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 668 | Open in IMG/M |
3300012212|Ga0150985_100093445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 583 | Open in IMG/M |
3300012212|Ga0150985_110640515 | Not Available | 585 | Open in IMG/M |
3300012212|Ga0150985_116103056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 694 | Open in IMG/M |
3300012371|Ga0134022_1026214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 526 | Open in IMG/M |
3300012371|Ga0134022_1188296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 612 | Open in IMG/M |
3300012372|Ga0134037_1116082 | Not Available | 788 | Open in IMG/M |
3300012372|Ga0134037_1144691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 547 | Open in IMG/M |
3300012374|Ga0134039_1116088 | Not Available | 516 | Open in IMG/M |
3300012377|Ga0134029_1220375 | Not Available | 511 | Open in IMG/M |
3300012378|Ga0134025_1151318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 776 | Open in IMG/M |
3300012378|Ga0134025_1168157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 521 | Open in IMG/M |
3300012380|Ga0134047_1018882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 648 | Open in IMG/M |
3300012380|Ga0134047_1060972 | Not Available | 814 | Open in IMG/M |
3300012380|Ga0134047_1073622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 681 | Open in IMG/M |
3300012380|Ga0134047_1119867 | Not Available | 810 | Open in IMG/M |
3300012383|Ga0134033_1206206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 527 | Open in IMG/M |
3300012384|Ga0134036_1093154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 608 | Open in IMG/M |
3300012385|Ga0134023_1044005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 533 | Open in IMG/M |
3300012386|Ga0134046_1077409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 665 | Open in IMG/M |
3300012387|Ga0134030_1042131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 781 | Open in IMG/M |
3300012390|Ga0134054_1133779 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 735 | Open in IMG/M |
3300012390|Ga0134054_1248947 | Not Available | 564 | Open in IMG/M |
3300012392|Ga0134043_1109702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 700 | Open in IMG/M |
3300012392|Ga0134043_1262065 | Not Available | 740 | Open in IMG/M |
3300012396|Ga0134057_1113897 | Not Available | 509 | Open in IMG/M |
3300012398|Ga0134051_1297997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 664 | Open in IMG/M |
3300012398|Ga0134051_1368658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 644 | Open in IMG/M |
3300012469|Ga0150984_114787194 | Not Available | 579 | Open in IMG/M |
3300012725|Ga0157610_1189825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 819 | Open in IMG/M |
3300012763|Ga0138289_1150815 | Not Available | 580 | Open in IMG/M |
3300012772|Ga0138287_1149039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 766 | Open in IMG/M |
3300012913|Ga0157298_10178953 | Not Available | 661 | Open in IMG/M |
3300012968|Ga0129337_1376587 | Not Available | 778 | Open in IMG/M |
3300012970|Ga0129338_1156328 | Not Available | 573 | Open in IMG/M |
3300013052|Ga0154014_133850 | Not Available | 716 | Open in IMG/M |
3300013078|Ga0153914_1091554 | Not Available | 769 | Open in IMG/M |
3300013080|Ga0153913_1115645 | Not Available | 537 | Open in IMG/M |
3300013295|Ga0170791_10621414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 542 | Open in IMG/M |
3300014325|Ga0163163_13261595 | Not Available | 506 | Open in IMG/M |
3300019199|Ga0187789_1152145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 773 | Open in IMG/M |
3300019199|Ga0187789_1219075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 748 | Open in IMG/M |
3300019199|Ga0187789_1259380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 807 | Open in IMG/M |
3300019199|Ga0187789_1280265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 593 | Open in IMG/M |
3300019201|Ga0180032_1140408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300019210|Ga0179938_1218233 | Not Available | 755 | Open in IMG/M |
3300019212|Ga0180106_1256715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 722 | Open in IMG/M |
3300019216|Ga0179939_1004328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 590 | Open in IMG/M |
3300019216|Ga0179939_1036995 | Not Available | 594 | Open in IMG/M |
3300019228|Ga0180119_1219491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 653 | Open in IMG/M |
3300019228|Ga0180119_1220308 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 559 | Open in IMG/M |
3300019229|Ga0180116_1037963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 656 | Open in IMG/M |
3300019229|Ga0180116_1081845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 662 | Open in IMG/M |
3300019229|Ga0180116_1135747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 572 | Open in IMG/M |
3300019232|Ga0180114_1000085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 662 | Open in IMG/M |
3300019232|Ga0180114_1161838 | Not Available | 512 | Open in IMG/M |
3300019232|Ga0180114_1286129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 636 | Open in IMG/M |
3300019232|Ga0180114_1325840 | Not Available | 531 | Open in IMG/M |
3300019233|Ga0184645_1033062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 658 | Open in IMG/M |
3300019233|Ga0184645_1150859 | Not Available | 552 | Open in IMG/M |
3300019233|Ga0184645_1176292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 507 | Open in IMG/M |
3300019233|Ga0184645_1310388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 532 | Open in IMG/M |
3300019234|Ga0172288_1122794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 591 | Open in IMG/M |
3300019234|Ga0172288_1131514 | Not Available | 738 | Open in IMG/M |
3300019236|Ga0179944_1265988 | Not Available | 532 | Open in IMG/M |
3300019238|Ga0180112_1324839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 786 | Open in IMG/M |
3300019238|Ga0180112_1326326 | Not Available | 629 | Open in IMG/M |
3300019240|Ga0181510_1011194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 809 | Open in IMG/M |
3300019241|Ga0187793_1422570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 662 | Open in IMG/M |
3300019244|Ga0180111_1002303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 510 | Open in IMG/M |
3300019244|Ga0180111_1082730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 653 | Open in IMG/M |
3300019245|Ga0187791_1196236 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 758 | Open in IMG/M |
3300019245|Ga0187791_1215314 | Not Available | 755 | Open in IMG/M |
3300019245|Ga0187791_1269902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 798 | Open in IMG/M |
3300019245|Ga0187791_1315590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 752 | Open in IMG/M |
3300019246|Ga0172287_1139870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 763 | Open in IMG/M |
3300019246|Ga0172287_1264099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 788 | Open in IMG/M |
3300019246|Ga0172287_1391376 | Not Available | 595 | Open in IMG/M |
3300019246|Ga0172287_1391807 | Not Available | 538 | Open in IMG/M |
3300019248|Ga0180117_1229610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 500 | Open in IMG/M |
3300019248|Ga0180117_1421931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 742 | Open in IMG/M |
3300019249|Ga0184648_1249803 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300019250|Ga0187790_1044094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 606 | Open in IMG/M |
3300019250|Ga0187790_1063106 | Not Available | 546 | Open in IMG/M |
3300019250|Ga0187790_1241993 | Not Available | 527 | Open in IMG/M |
3300019250|Ga0187790_1248805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 757 | Open in IMG/M |
3300019252|Ga0172286_1105730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 756 | Open in IMG/M |
3300019254|Ga0184641_1314633 | Not Available | 769 | Open in IMG/M |
3300019255|Ga0184643_1188071 | Not Available | 512 | Open in IMG/M |
3300019259|Ga0184646_1090461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 651 | Open in IMG/M |
3300019265|Ga0187792_1013408 | Not Available | 688 | Open in IMG/M |
3300019269|Ga0184644_1597282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 705 | Open in IMG/M |
3300020064|Ga0180107_1320287 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 559 | Open in IMG/M |
3300020066|Ga0180108_1093325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 533 | Open in IMG/M |
3300020067|Ga0180109_1018614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 698 | Open in IMG/M |
3300020067|Ga0180109_1477049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 753 | Open in IMG/M |
3300020070|Ga0206356_11244319 | Not Available | 516 | Open in IMG/M |
3300020078|Ga0206352_10458757 | Not Available | 796 | Open in IMG/M |
3300020081|Ga0206354_10408151 | Not Available | 507 | Open in IMG/M |
3300021257|Ga0210329_127645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 506 | Open in IMG/M |
3300021258|Ga0210345_152338 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 564 | Open in IMG/M |
3300021259|Ga0179581_114230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 674 | Open in IMG/M |
3300021263|Ga0210343_148538 | Not Available | 505 | Open in IMG/M |
3300021273|Ga0210340_1037418 | Not Available | 559 | Open in IMG/M |
3300021273|Ga0210340_1125441 | Not Available | 512 | Open in IMG/M |
3300021273|Ga0210340_1127812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 685 | Open in IMG/M |
3300021278|Ga0210332_125491 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 761 | Open in IMG/M |
3300021283|Ga0210357_1023549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 512 | Open in IMG/M |
3300021286|Ga0179583_1055533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 707 | Open in IMG/M |
3300021292|Ga0210355_1012370 | Not Available | 508 | Open in IMG/M |
3300021294|Ga0210325_1126635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 661 | Open in IMG/M |
3300021307|Ga0179585_1145138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 611 | Open in IMG/M |
3300021315|Ga0179958_1182199 | Not Available | 747 | Open in IMG/M |
3300021329|Ga0210362_1085028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 534 | Open in IMG/M |
3300021329|Ga0210362_1256089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 666 | Open in IMG/M |
3300021329|Ga0210362_1297720 | Not Available | 531 | Open in IMG/M |
3300021329|Ga0210362_1312390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 511 | Open in IMG/M |
3300021330|Ga0210363_1285953 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 586 | Open in IMG/M |
3300021332|Ga0210339_1033076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 623 | Open in IMG/M |
3300021333|Ga0210324_1061866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 594 | Open in IMG/M |
3300021333|Ga0210324_1379508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 696 | Open in IMG/M |
3300021853|Ga0210323_1000051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 810 | Open in IMG/M |
3300021853|Ga0210323_1030193 | Not Available | 507 | Open in IMG/M |
3300021853|Ga0210323_1031342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 636 | Open in IMG/M |
3300021853|Ga0210323_1033821 | Not Available | 564 | Open in IMG/M |
3300021853|Ga0210323_1100633 | Not Available | 510 | Open in IMG/M |
3300021857|Ga0213849_1057617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 780 | Open in IMG/M |
3300021857|Ga0213849_1273172 | Not Available | 504 | Open in IMG/M |
3300021929|Ga0213845_1013602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 779 | Open in IMG/M |
3300021938|Ga0213847_1237408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 666 | Open in IMG/M |
3300021938|Ga0213847_1237651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 751 | Open in IMG/M |
3300021947|Ga0213856_1070147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 612 | Open in IMG/M |
3300021947|Ga0213856_1171088 | Not Available | 514 | Open in IMG/M |
3300021947|Ga0213856_1265691 | Not Available | 551 | Open in IMG/M |
3300021951|Ga0222624_1170182 | Not Available | 519 | Open in IMG/M |
3300022141|Ga0213933_127206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 557 | Open in IMG/M |
3300022154|Ga0213929_1010864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 810 | Open in IMG/M |
3300022154|Ga0213929_1014689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 719 | Open in IMG/M |
3300022156|Ga0213934_1029711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 735 | Open in IMG/M |
3300022156|Ga0213934_1041658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 631 | Open in IMG/M |
3300022195|Ga0222625_1070461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 524 | Open in IMG/M |
3300022368|Ga0210346_120707 | Not Available | 525 | Open in IMG/M |
3300022373|Ga0210319_1009974 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
3300022385|Ga0210376_1048081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 669 | Open in IMG/M |
3300022499|Ga0242641_1015224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 733 | Open in IMG/M |
3300022529|Ga0242668_1038416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 811 | Open in IMG/M |
3300022708|Ga0242670_1020490 | Not Available | 787 | Open in IMG/M |
3300022713|Ga0242677_1057061 | Not Available | 586 | Open in IMG/M |
3300022718|Ga0242675_1031920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300022721|Ga0242666_1091567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 694 | Open in IMG/M |
3300023546|Ga0228705_105925 | Not Available | 511 | Open in IMG/M |
3300023700|Ga0228707_1028166 | Not Available | 807 | Open in IMG/M |
3300023703|Ga0228708_1030375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 807 | Open in IMG/M |
3300023708|Ga0228709_1054241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300023708|Ga0228709_1121230 | Not Available | 531 | Open in IMG/M |
3300024480|Ga0255223_1101422 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 500 | Open in IMG/M |
3300024481|Ga0256330_1102557 | Not Available | 604 | Open in IMG/M |
3300024483|Ga0255224_1059287 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 792 | Open in IMG/M |
3300024485|Ga0256318_1116998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 567 | Open in IMG/M |
3300024495|Ga0255164_1030495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 887 | Open in IMG/M |
3300024530|Ga0256322_1045689 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300024530|Ga0256322_1048468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 779 | Open in IMG/M |
3300024531|Ga0255228_1053157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300024534|Ga0256357_1054577 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 776 | Open in IMG/M |
3300024534|Ga0256357_1097319 | Not Available | 570 | Open in IMG/M |
3300024535|Ga0255303_1052538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
3300024536|Ga0256338_1160818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 502 | Open in IMG/M |
3300024540|Ga0255300_1041184 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 776 | Open in IMG/M |
3300024542|Ga0256350_1046600 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 771 | Open in IMG/M |
3300024542|Ga0256350_1057668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 691 | Open in IMG/M |
3300024543|Ga0256348_1038471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300024543|Ga0256348_1045821 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 738 | Open in IMG/M |
3300024544|Ga0255294_1051987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 731 | Open in IMG/M |
3300024544|Ga0255294_1073435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 609 | Open in IMG/M |
3300024544|Ga0255294_1087954 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 555 | Open in IMG/M |
3300024546|Ga0256356_1082343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 591 | Open in IMG/M |
3300024547|Ga0255292_1088779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 607 | Open in IMG/M |
3300024552|Ga0256345_1050477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300024553|Ga0255301_1077599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 596 | Open in IMG/M |
3300024557|Ga0255283_1069013 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 766 | Open in IMG/M |
3300024559|Ga0255284_1060977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300024569|Ga0255243_1076597 | Not Available | 833 | Open in IMG/M |
3300024570|Ga0255276_1098384 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 780 | Open in IMG/M |
3300024572|Ga0255268_1137716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 607 | Open in IMG/M |
3300024861|Ga0256312_1144522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 505 | Open in IMG/M |
3300024864|Ga0255271_1127641 | Not Available | 555 | Open in IMG/M |
3300025744|Ga0255245_1022866 | Not Available | 787 | Open in IMG/M |
3300025744|Ga0255245_1033861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 643 | Open in IMG/M |
3300025749|Ga0256314_1028868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 812 | Open in IMG/M |
3300025760|Ga0255249_1046909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 740 | Open in IMG/M |
3300026384|Ga0213907_120897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 629 | Open in IMG/M |
3300026402|Ga0255304_1051123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 506 | Open in IMG/M |
3300026412|Ga0256326_1031786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300026415|Ga0256298_1048770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 578 | Open in IMG/M |
3300026429|Ga0255253_1062701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 597 | Open in IMG/M |
3300026429|Ga0255253_1069275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 566 | Open in IMG/M |
3300026444|Ga0256364_1048595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 733 | Open in IMG/M |
3300026454|Ga0256319_1054275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 790 | Open in IMG/M |
3300026563|Ga0256355_1044999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 770 | Open in IMG/M |
3300026566|Ga0256334_1096885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 672 | Open in IMG/M |
3300026568|Ga0255240_1067394 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300026571|Ga0255289_1115925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 604 | Open in IMG/M |
3300026571|Ga0255289_1117045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 600 | Open in IMG/M |
3300026573|Ga0255269_1163916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 594 | Open in IMG/M |
3300027578|Ga0255075_1061444 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 667 | Open in IMG/M |
3300028077|Ga0256323_1054432 | Not Available | 564 | Open in IMG/M |
3300028089|Ga0255299_1057015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 730 | Open in IMG/M |
3300028097|Ga0255261_1030795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 877 | Open in IMG/M |
3300028100|Ga0256363_1044135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 752 | Open in IMG/M |
3300028101|Ga0256349_1039482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 806 | Open in IMG/M |
3300028108|Ga0256305_1075015 | Not Available | 827 | Open in IMG/M |
3300028112|Ga0256335_1152626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 602 | Open in IMG/M |
3300028113|Ga0255234_1144836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 625 | Open in IMG/M |
3300028116|Ga0255291_100985 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300028117|Ga0255290_102070 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 790 | Open in IMG/M |
3300028118|Ga0256351_103631 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 753 | Open in IMG/M |
3300028255|Ga0255226_1040829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 603 | Open in IMG/M |
3300028257|Ga0255257_1062035 | Not Available | 500 | Open in IMG/M |
3300028261|Ga0256316_1080193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 569 | Open in IMG/M |
3300028267|Ga0256358_1055875 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 777 | Open in IMG/M |
3300028271|Ga0255256_1049823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 734 | Open in IMG/M |
3300028619|Ga0257136_1043341 | Not Available | 815 | Open in IMG/M |
3300028619|Ga0257136_1048404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 763 | Open in IMG/M |
3300028621|Ga0257142_1043153 | Not Available | 821 | Open in IMG/M |
3300028623|Ga0257141_1045628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 827 | Open in IMG/M |
3300028647|Ga0272412_1199154 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 829 | Open in IMG/M |
3300028647|Ga0272412_1260134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 705 | Open in IMG/M |
3300029639|Ga0265597_101676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
3300029674|Ga0265604_115657 | Not Available | 781 | Open in IMG/M |
3300029674|Ga0265604_116326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 763 | Open in IMG/M |
3300029674|Ga0265604_116380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 762 | Open in IMG/M |
3300029685|Ga0265603_1018556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 859 | Open in IMG/M |
3300029685|Ga0265603_1029462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 665 | Open in IMG/M |
3300029691|Ga0265598_1030935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 849 | Open in IMG/M |
3300030552|Ga0247654_1182025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 531 | Open in IMG/M |
3300030600|Ga0247659_1148632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 576 | Open in IMG/M |
3300030621|Ga0247655_10049095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 873 | Open in IMG/M |
3300030628|Ga0247629_10276883 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 605 | Open in IMG/M |
3300030829|Ga0308203_1044385 | Not Available | 658 | Open in IMG/M |
3300030829|Ga0308203_1092237 | Not Available | 510 | Open in IMG/M |
3300030831|Ga0308152_110611 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 574 | Open in IMG/M |
3300030902|Ga0308202_1064647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 698 | Open in IMG/M |
3300030902|Ga0308202_1136578 | Not Available | 536 | Open in IMG/M |
3300030903|Ga0308206_1054221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300030903|Ga0308206_1102168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 644 | Open in IMG/M |
3300030903|Ga0308206_1131573 | Not Available | 588 | Open in IMG/M |
3300030903|Ga0308206_1196002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 510 | Open in IMG/M |
3300030903|Ga0308206_1198677 | Not Available | 507 | Open in IMG/M |
3300030904|Ga0308198_1027155 | Not Available | 800 | Open in IMG/M |
3300030904|Ga0308198_1040448 | Not Available | 696 | Open in IMG/M |
3300030904|Ga0308198_1041752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 689 | Open in IMG/M |
3300030904|Ga0308198_1044209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 675 | Open in IMG/M |
3300030905|Ga0308200_1120352 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 579 | Open in IMG/M |
3300030988|Ga0308183_1121866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 616 | Open in IMG/M |
3300030989|Ga0308196_1026572 | Not Available | 708 | Open in IMG/M |
3300030990|Ga0308178_1061894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 724 | Open in IMG/M |
3300030997|Ga0073997_10073362 | Not Available | 582 | Open in IMG/M |
3300031036|Ga0073978_1628217 | Not Available | 811 | Open in IMG/M |
3300031058|Ga0308189_10349272 | Not Available | 595 | Open in IMG/M |
3300031082|Ga0308192_1073402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 548 | Open in IMG/M |
3300031091|Ga0308201_10298856 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 573 | Open in IMG/M |
3300031092|Ga0308204_10320539 | Not Available | 525 | Open in IMG/M |
3300031093|Ga0308197_10093895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 875 | Open in IMG/M |
3300031094|Ga0308199_1077908 | Not Available | 697 | Open in IMG/M |
3300031094|Ga0308199_1080037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 690 | Open in IMG/M |
3300031094|Ga0308199_1087743 | Not Available | 667 | Open in IMG/M |
3300031095|Ga0308184_1018734 | Not Available | 728 | Open in IMG/M |
3300031098|Ga0308191_1029203 | Not Available | 580 | Open in IMG/M |
3300031114|Ga0308187_10254038 | Not Available | 640 | Open in IMG/M |
3300031421|Ga0308194_10137557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 741 | Open in IMG/M |
3300031422|Ga0308186_1017946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 666 | Open in IMG/M |
3300031424|Ga0308179_1014655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 806 | Open in IMG/M |
3300031424|Ga0308179_1025464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 676 | Open in IMG/M |
3300031487|Ga0314823_107164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 702 | Open in IMG/M |
3300031493|Ga0314826_114191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 801 | Open in IMG/M |
3300031493|Ga0314826_128015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 581 | Open in IMG/M |
3300032177|Ga0315276_11099557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 842 | Open in IMG/M |
3300033528|Ga0316588_1085535 | Not Available | 783 | Open in IMG/M |
3300034092|Ga0335010_0136906 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1572 | Open in IMG/M |
3300034363|Ga0326787_069955 | Not Available | 521 | Open in IMG/M |
3300034447|Ga0370544_09762 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 704 | Open in IMG/M |
3300034448|Ga0370540_04298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 756 | Open in IMG/M |
3300034479|Ga0314785_002007 | Not Available | 1155 | Open in IMG/M |
3300034480|Ga0314789_008281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 817 | Open in IMG/M |
3300034480|Ga0314789_019542 | Not Available | 609 | Open in IMG/M |
3300034480|Ga0314789_021799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 587 | Open in IMG/M |
3300034644|Ga0370548_117672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 553 | Open in IMG/M |
3300034653|Ga0316599_088355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
3300034659|Ga0314780_052749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 819 | Open in IMG/M |
3300034659|Ga0314780_113230 | Not Available | 632 | Open in IMG/M |
3300034659|Ga0314780_219090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 505 | Open in IMG/M |
3300034661|Ga0314782_136315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 590 | Open in IMG/M |
3300034662|Ga0314783_049721 | Not Available | 785 | Open in IMG/M |
3300034664|Ga0314786_083581 | Not Available | 661 | Open in IMG/M |
3300034664|Ga0314786_111678 | Not Available | 600 | Open in IMG/M |
3300034664|Ga0314786_127579 | Not Available | 575 | Open in IMG/M |
3300034664|Ga0314786_172730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 520 | Open in IMG/M |
3300034666|Ga0314788_073746 | Not Available | 722 | Open in IMG/M |
3300034666|Ga0314788_077008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 711 | Open in IMG/M |
3300034667|Ga0314792_137112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 643 | Open in IMG/M |
3300034668|Ga0314793_059808 | Not Available | 719 | Open in IMG/M |
3300034672|Ga0314797_095759 | Not Available | 603 | Open in IMG/M |
3300034672|Ga0314797_136213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 533 | Open in IMG/M |
3300034673|Ga0314798_113416 | Not Available | 586 | Open in IMG/M |
3300034676|Ga0314801_134726 | Not Available | 585 | Open in IMG/M |
3300034680|Ga0370541_030783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 645 | Open in IMG/M |
3300034681|Ga0370546_087320 | Not Available | 528 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 14.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.84% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 9.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.03% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 7.00% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 6.77% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.74% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 3.39% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.71% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.48% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 2.48% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.26% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.03% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.13% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.90% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.90% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.68% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.45% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.45% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.45% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.45% |
Wastewater Treatment | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment | 0.45% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.45% |
Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.45% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.23% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.23% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.23% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.23% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.23% |
Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.23% |
Enriched Soil Aggregate | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate | 0.23% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.23% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.23% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.23% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.23% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.23% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.23% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.23% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.23% |
Subtropical Soil | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil | 0.23% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2209111013 | Subtropical soil microbial communities from Bundaberg Australia-rainforest | Environmental | Open in IMG/M |
3300001199 | Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly | Environmental | Open in IMG/M |
3300001448 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk Metatranscriptome | Environmental | Open in IMG/M |
3300002658 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF127 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300003710 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004577 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 20_HOW5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004585 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 16_LOW5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004622 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time C-32min-Anaerobic_ RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300004624 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time B -10min-Anaerobic_ RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006372 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006378 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006934 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007219 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007323 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_C2_LD (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300008884 | Microbial communities of wastewater sludge from Singapore - Sludge3_b2_February | Environmental | Open in IMG/M |
3300009206 | Microbial communities of wastewater sludge from Singapore - Sludge11_b2_February | Environmental | Open in IMG/M |
3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
3300009230 | Microbial communities of water from Amazon river, Brazil - RCM8 | Environmental | Open in IMG/M |
3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
3300009249 | Microbial communities of water from Amazon river, Brazil - RCM15 | Environmental | Open in IMG/M |
3300009252 | Microbial communities of water from Amazon river, Brazil - RCM16 | Environmental | Open in IMG/M |
3300009254 | Microbial communities of water from Amazon river, Brazil - RCM20 | Environmental | Open in IMG/M |
3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
3300009261 | Microbial communities of water from Amazon river, Brazil - RCM23 | Environmental | Open in IMG/M |
3300009337 | Microbial communities of water from Amazon river, Brazil - RCM17 | Environmental | Open in IMG/M |
3300009352 | Microbial communities of water from Amazon river, Brazil - RCM18 | Environmental | Open in IMG/M |
3300009579 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009580 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009583 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009584 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009586 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009587 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009755 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010065 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010071 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010078 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010079 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010080 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010084 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010091 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010116 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010137 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010138 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010144 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010896 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011282 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2012 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013078 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013080 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300019199 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019210 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC030_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019216 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC032_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019234 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019236 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC10_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019246 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021257 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.272 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021258 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.445 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021259 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_2_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021263 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.433 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021273 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021278 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.302 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021283 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.587 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021286 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021292 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.493 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021294 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.264 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021330 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.629 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021333 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021853 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.189 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021929 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021938 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - EE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021947 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022141 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022154 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022368 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.454 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022373 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.180 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022385 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S771 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023546 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 2-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023700 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023703 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024485 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
3300024530 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024534 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024535 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024540 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024542 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024543 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024544 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024546 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024547 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024553 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024861 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025744 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025749 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025760 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026384 | Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0896-MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026402 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026412 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026429 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026444 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026454 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026563 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
3300028077 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028089 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028097 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028100 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028101 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028116 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028117 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028118 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028255 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028257 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028261 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028267 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028271 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028619 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028621 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028623 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300029639 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029674 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_50m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029685 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029691 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030552 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030600 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030621 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030628 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031036 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031098 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031487 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031493 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034363 | Metatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S96 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300034447 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034448 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034479 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034480 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034653 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_03R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DRAFT_00000050 | 2209111013 | Subtropical Soil | MPLVGFRRREGRAAPVAASLSPVTRDYPSRALSDH |
J055_101331101 | 3300001199 | Lotic | MPRVGFRRLEGRAEPASANHSPVTRDYPSRALSDVFQAAALRLFYQGTRETVEVLRRK* |
JGI20219J14954_10057901 | 3300001448 | Wetland | MPRAGLRRLEGMTTPAVATHSPVTRDYPSRALNDVFQAAALRLF |
Ga0005478J37266_1045631 | 3300002658 | Forest Soil | MPSGRFRSLEGRAAPAAANHSPVTRDYPSRAFGDLFQNHRAAT |
Ga0008089_1029281 | 3300003710 | Tropical Rainforest Soil | MPLVGFRRLEGRAAPVAANHSPVTRDYPSRALSDVFQAAARSTV |
Ga0066502_1605302 | 3300004577 | Freshwater Sediment | MPLTGFRLWEGMAAPAATNLSPVTRDYPSRALSDVFQAAALR |
Ga0066500_1177032 | 3300004585 | Freshwater Sediment | MPLTGFRLWEGMAAPAATNLSPVTRDYPSRALSDVFQAAALRL |
Ga0058865_10521881 | 3300004622 | Wastewater Treatment | MPLDGLRRLEGRMAPAAIRHSPVARDYPSRALSGVFQTAAPRLFY |
Ga0058864_10468011 | 3300004624 | Wastewater Treatment | MPLDGLRRLEGRMAPAAIRHSPVARDYPSRALSGVFQTAAPRLFYQGTV |
Ga0058858_10172142 | 3300004785 | Host-Associated | MPLTGFRQWEGTATPVVAALSPVARDYPSRALSDVFQAAALR |
Ga0058858_10273941 | 3300004785 | Host-Associated | MPLVGFRRQEGKAAPAAAYLSPVARDYPSRALSDVFQAAALRLF |
Ga0007756_100600011 | 3300004795 | Freshwater Lake | MPRVGFRRLEGMAEPASANHSPVTRDYPSRALSDVFQAAALRLF |
Ga0058859_100542732 | 3300004798 | Host-Associated | MPLVGFRRQEGKATPVVASLSPVARDYPSRALSDVFQAAALRL |
Ga0058859_100891851 | 3300004798 | Host-Associated | MPLVGFRLLEGRAEPASANHSPVTRDYPSRARVDLFQAAALRLFY |
Ga0058859_100902611 | 3300004798 | Host-Associated | MPLVGFRLLEGRAEPASANHSPVARDYPSRARVDLFQAAALRLFY |
Ga0058859_101258051 | 3300004798 | Host-Associated | MPLVGFRRQEGVAAPAAANLSPVARDYPSRALSDVFQAAALRLFY |
Ga0058859_101445711 | 3300004798 | Host-Associated | MPLVGFRRLEGRAEPASANHSPVTRDYPSRARVDLFQAAALRLF |
Ga0058859_101478302 | 3300004798 | Host-Associated | MPLNRLSPLGGEGDTSVASHSPVARDYPSRALSDVFQAAA |
Ga0058860_100961901 | 3300004801 | Host-Associated | MPRIACALEGRAAPAATRHSPVAREYPSRARVDLFQAAALRLF |
Ga0058860_102250881 | 3300004801 | Host-Associated | MPLGDFRHQEGRATPVVASHSPVARDYPSRALSDVFQAAA |
Ga0058860_102338301 | 3300004801 | Host-Associated | MPLVGFRRQEGVAAPAAANLSPVARDYPSRALSDVFQAAALRLF |
Ga0070690_1007164881 | 3300005330 | Switchgrass Rhizosphere | MPLVGFRLLEGRAEPASANHSPVARDYPSRARVDLFQAAALRLFYQGTTTTVRVVREV* |
Ga0070707_1005099291 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLVGFRRLEGRAAPAAANLSPVARDYPSRALSDVFQAAALRLFYQGTSATMCVVREK* |
Ga0079957_12410701 | 3300005805 | Lake | MPLGGFRRLGGEGGTSATIHSPVARDYPSCAFSDVFQAAAPQLFYQGTGK |
Ga0075489_12981412 | 3300006372 | Aqueous | MPPSGLRRSEGRATPAVAILSPVTRDHPSRALNGVFQAVALRLF |
Ga0075498_10156221 | 3300006378 | Aqueous | MPLAGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAA |
Ga0075498_10893441 | 3300006378 | Aqueous | MPLNRLRVLEGRAAPAATNLSPVARDYPSRALGGLFQAAALRL |
Ga0080680_10231611 | 3300006934 | Tropical Rainforest Soil | MPLVGFRRLGGEGGTIAASHSPVTRDYPSRALSDVFQAAARSTV |
Ga0075025_10301121 | 3300007219 | Watersheds | MPLAGFRRLEGRAAPAAANHSPVTRDYPSRARVDLFQAAALRL |
Ga0075025_10554031 | 3300007219 | Watersheds | MPLVGFRRQEGKAAPAAANLSPVARDYPSRARVDLFQAAALRLF |
Ga0099768_11132471 | 3300007323 | Activated Sludge | MPHNRLSPLEGRAAPTAATHSPVARDYPSRALSDVFQAAALRL |
Ga0103746_100183481 | 3300008884 | Wastewater Sludge | MPPDGLHRLEGRATPAVANLSPVARDYPSRAFSGVFQAVALRLF |
Ga0103750_10162451 | 3300009206 | Wastewater Sludge | MPPDGLHRLEGRATPAVANLSPVARDYPSRAFSGVFQAVALRL |
Ga0103851_10411151 | 3300009225 | River Water | MPLNDLRRLEGMATPAVATLSPVARDYPSRALSDVFQ |
Ga0103855_100417572 | 3300009230 | River Water | MPPDGLSRPEGKATPAVAILSPVTRDYPSRALNGVFQ |
Ga0103855_100605331 | 3300009230 | River Water | MPILGLRRLKGRATPAVAIHSPVTRDYPSRALGDVF |
Ga0103855_101165741 | 3300009230 | River Water | MPRNGLRRLEGRATPAVATHSPVTRDYPSRALSDVFQA |
Ga0103856_100479701 | 3300009233 | River Water | MPLSRLRVLEGRAAPAATNLSPVARDYPSRALGGLFQAA |
Ga0103856_100515371 | 3300009233 | River Water | MPRNGLRRLEGRATPAVATHSPVTRDYPSRALSDVFQ |
Ga0103856_100522021 | 3300009233 | River Water | MPLNGLRRLEGRATPAAANHSPVTRDYPSRALSDVFQAAALR |
Ga0103857_100288212 | 3300009235 | River Water | MPLIGFRRREGRAAPAATFRSPVARDYLSRAFSDVFQAAAPLSS |
Ga0103857_100290452 | 3300009235 | River Water | MPLNGLRRLEGRATPAAANHSPVTRDYPSRALSDVFQAAALRLF |
Ga0103857_100622421 | 3300009235 | River Water | MPLSRLRVLEGRAAPAATNLSPVARDYPSRALGGLFQ |
Ga0103857_100696151 | 3300009235 | River Water | MPRNGLRRLEGRATPAVATHSPVTRDYPSRALSDVFQAAA |
Ga0103858_100979932 | 3300009239 | River Water | MPLSRLRVLEGRAAPAATNLSPVARDYPSRALGGLFQAAAL |
Ga0103858_100992331 | 3300009239 | River Water | MPRTGLRRLEGMTTPAVATHSPVTRDYPSRALHDVFQ |
Ga0103858_101077771 | 3300009239 | River Water | MPLIGFRRREGRAAPAATFRSPVARDYLSRAFSDVFQAA |
Ga0103858_101080561 | 3300009239 | River Water | MPLAGLRRLEGKTTPAVAIHSPVTRDYPSRALSDVFQVA |
Ga0103860_100471891 | 3300009243 | River Water | MPLFGSRHREGRAAPAATFRSPVARDYLSRAFSDVFQAAAPR |
Ga0103860_100471951 | 3300009243 | River Water | MPLVGFRRQEGRAAPAATHHSPVARDYPSRAFSDVFQAAAPR |
Ga0103860_100483711 | 3300009243 | River Water | MPLAGLRRLEGKTTPAVAIHSPVTRDYPSRALSDVFQAA |
Ga0103861_100239692 | 3300009247 | River Water | MPLFGSRHREGRAAPAATFRSPVARDYLSRAFSDVFQAAAP |
Ga0103861_100244581 | 3300009247 | River Water | MPPGGLRRPEGRATPAVAALSPVTRDYPSRALNGVFQAV |
Ga0103861_100546141 | 3300009247 | River Water | MPRNGLRRLEGRATPAVATHSPVTRDYPSRALSDVF |
Ga0103862_10353961 | 3300009249 | River Water | MPLNGLRRLEGRATPAAANHSPVTRDYPSRALSDVFQ |
Ga0103863_100170071 | 3300009252 | River Water | MPLVGFRRQEGRAAPAATHHSPVARDYPSRAFSDVFQAAAP |
Ga0103863_100468531 | 3300009252 | River Water | MPLNGLRRLEGRATPAAANHSPVTRDYPSRALSDVF |
Ga0103867_10117151 | 3300009254 | River Water | MPLVGFRRREGRAAPAATFRSPVARDYLSRAFSGLK |
Ga0103869_101075121 | 3300009257 | River Water | MPPDGLSRPEGKATPAVAILSPVTRDYPSRALNGVFQAVALA |
Ga0103869_101086731 | 3300009257 | River Water | MPLVGFRRQEGRAAPAATHHSPVARDYPSRAFSDVFQAAA |
Ga0103870_10164202 | 3300009261 | River Water | MPLVGFRRREGRAAPAATFRSPVARDYLSRAFSDVFQAAAPR |
Ga0103864_10024322 | 3300009337 | River Water | MPLVGFRRREGRAAPAATFRSPVARDYLSRAFSDVFQAAAP |
Ga0103865_10033872 | 3300009352 | River Water | MPLVGFRRREGRAAPAATFRSPVARDYLSRAFSDVFQAAA |
Ga0115599_10412721 | 3300009579 | Wetland | MPLAGLRRLEGKATPVVAIHSPVTRDYPSRALSDVFQAAALRL |
Ga0115599_10575491 | 3300009579 | Wetland | MPRNRLSPLEGRAAPAAATHSPVARDYPSRALSDVFQAAALRLF |
Ga0115599_10635021 | 3300009579 | Wetland | MPRNGSRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRL |
Ga0115596_10130731 | 3300009580 | Wetland | MPLAGLRRLEGRMAPAAIRHSPVARDYPSRALSGVFQAAAPR |
Ga0115596_10710801 | 3300009580 | Wetland | MPRNGSRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAA |
Ga0115596_11072021 | 3300009580 | Wetland | MPLVGLRRREGMSTPAVGIHSPVTRDYPSRALSDVFQ |
Ga0115596_11550591 | 3300009580 | Wetland | MPRAGFRRLEGRAEPASATHSPVARDYPSRALSDVFQAAALRLF |
Ga0115600_10324761 | 3300009581 | Wetland | MPRNGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRL |
Ga0115600_10338741 | 3300009581 | Wetland | MPRNWLSPLEGRAAPAAATHSPVARDYPSRALSDVFQAAALRL |
Ga0115601_10052121 | 3300009582 | Wetland | MPLDGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRL |
Ga0115601_11438121 | 3300009582 | Wetland | MPLVGLRRREGMSTPAVGIHSPVTRDYPSRALSDVFQVAALSTVL |
Ga0115598_10290401 | 3300009583 | Wetland | MPRVGLRRLEGRAEPASAIHSPVTRDYPSRALSDVFQAAALRL |
Ga0115598_10436871 | 3300009583 | Wetland | MPFDGLRRLEGRATPAVTFHSPVTRDYPSRALNDVFQGRCAST |
Ga0115597_11593301 | 3300009584 | Wetland | MPRVGLRRLEGWAEPASANHSPVTRDYPSRALSDVFQAAALRL |
Ga0115591_10295701 | 3300009586 | Wetland | MPLVGLRRLEGMATPAVATHSPVTRDYPSRALSGVFQAAA |
Ga0115591_10319351 | 3300009586 | Wetland | MPLVGFRLLEGRAEPASANLSPVTRDYPSRALGDHFRPPRFDC |
Ga0115591_10375911 | 3300009586 | Wetland | MPFVGLRRREGMSTPAVGIHSPVTRDYPSRALSDVFQAAALRL |
Ga0115602_10120781 | 3300009587 | Wetland | MPRNRLSPLEGRAAPAAATHSPVARDYPSRALSDVFQAAALRL |
Ga0115602_10636352 | 3300009587 | Wetland | MPLDGLRRLEGKAAPVAASLSPVTRDYPSRALSGVFQAAALR |
Ga0115602_11453231 | 3300009587 | Wetland | MPRNGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRLF |
Ga0115592_10392291 | 3300009755 | Wetland | MPPGGLHRSEGRAKPAFAIHSPVARDYPSRALNGVFQ |
Ga0115592_10763961 | 3300009755 | Wetland | MPRVGLRRLEGRAEPASAHLSPVTRDYPSRARVDLFQAAA |
Ga0115592_11223091 | 3300009755 | Wetland | MPLVGLRRQEGMSTPAVGIHSPVTRDYPSRAFSDVFQVAALS |
Ga0115592_11443471 | 3300009755 | Wetland | MPLAGLRRLEGRATPAVATHSPVTRDYPSRALSDVFQAAALRLF |
Ga0115592_11561371 | 3300009755 | Wetland | MPLVDFRRQEGRTAPAATHLSPVARDYPSRARVDLFQAAALRLF |
Ga0115592_11661571 | 3300009755 | Wetland | MPLDGFHRLEGRATPVVANHSPVARDYPSRALSDVFQAAALRL |
Ga0127462_1733371 | 3300010061 | Grasslands Soil | MPLVGFRLQEGRAEPASANHSPVTRDYPSRARVDLFQAAALRL |
Ga0127435_1412142 | 3300010065 | Grasslands Soil | MPLVGFRLQEGTAEPASANHSPVTRDYPSRARVDLFQAAALR |
Ga0127477_1111511 | 3300010071 | Grasslands Soil | LPIIPLARLKGRVAPAATNLSPVTRDYPSRALSGVFQAPAL |
Ga0127487_1056481 | 3300010078 | Grasslands Soil | MPLVGFRLLEGRAEPASANLSPVTRDYPSRARDDLFQAATLRLFYQGTELVIYASRRFRL |
Ga0127487_1606771 | 3300010078 | Grasslands Soil | MPLVGLRRQEGRATPVVASLSPVARDYPSRALSDVFQAAALR |
Ga0127436_1330521 | 3300010079 | Grasslands Soil | LPIIPLARLKGRVAPAATNLSPVTRDYPSRALSGVFQAPALRL |
Ga0127448_1021411 | 3300010080 | Grasslands Soil | LPIEPLARLKGRAAPAATNLSPVTRDYPSRALSGVFQAPALR |
Ga0127461_10921571 | 3300010084 | Grasslands Soil | LPIIPLARLKGRVAPAATNLSPVTRDYPSRALSGVFQAPA |
Ga0127485_10053101 | 3300010091 | Grasslands Soil | MPLVGFRRQEGRAAPAAAHLSPVARDYPSRARVDLFQAAALRL |
Ga0127473_10234571 | 3300010096 | Grasslands Soil | MPLVGFRLQEGTAEPASANHSPVTRDYPSRARVDLFQAAALRLF |
Ga0127500_10613492 | 3300010103 | Grasslands Soil | LPIEPLARLKGRAAPAATNLSPVTRDYPSRALSGVFQTAA |
Ga0127497_10231501 | 3300010109 | Grasslands Soil | LPIEPLARLKGRAAPAATNLSPVTRDYPSRALSGVFQAPALRLF |
Ga0127491_10528151 | 3300010111 | Grasslands Soil | MPLAGFRRQEGRAAPAAANHSPVARDYPSRARVDLFQAAALR |
Ga0127460_10912491 | 3300010114 | Grasslands Soil | LPIIPLARLKGRVAPAATNLSPVTRDYPSRALSGVFQAPALRLF |
Ga0127466_10292891 | 3300010116 | Grasslands Soil | MPLVGFRRQEGRAAPAAAHLSPVARDYPSRARVDLFQAAALR |
Ga0127449_10562991 | 3300010117 | Grasslands Soil | MPLVGFRRLEGRAAPAATHLSPVTRDYPSRARSDVFQAAALR |
Ga0127449_11188071 | 3300010117 | Grasslands Soil | MPLVGFRRQEGRAAPAAANLSPVARDYPSRALSDVFQAAA |
Ga0127488_11301591 | 3300010122 | Grasslands Soil | MPLVGLRRQEGRATPVVASLSPVARDYPSRALSDVFQAAA |
Ga0127498_11704232 | 3300010124 | Grasslands Soil | MPLVGFRLLEGRAEPASANLSPVTRDYPSRARDDLFQAAALR |
Ga0127486_10435191 | 3300010128 | Grasslands Soil | MPLVGLRRQEGRATPVVASLSPVARDYPSRALSDVFQAAALRL |
Ga0115594_10136061 | 3300010131 | Wetland | MPLAGLRRLEGRMAPAAIRHSPVARDYPSRALSGVFQAAAPRL |
Ga0127459_10003451 | 3300010133 | Grasslands Soil | MPLVGFRLLEGRAEPASANLSPVTRDYPSRARVDLFQAAALRLF |
Ga0127447_11250461 | 3300010136 | Grasslands Soil | MPLVGFRRQEGRAAPAAANLSPVARDYPSRALSDVFQAAALR |
Ga0126323_11498171 | 3300010137 | Soil | MPLVGFRRQEGKAAPAATTLSPVARDYPSRALSDVFQAAALRLF |
Ga0115595_10458001 | 3300010138 | Wetland | MPPGGLRRPEGRATPAVATLSPVTRDYPSRALNGVFQAVALRL |
Ga0115595_10566771 | 3300010138 | Wetland | MPLAGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALR |
Ga0115595_11558211 | 3300010138 | Wetland | MPLAGLRRLEGRMAPAAIRHSPVARDYPSRALSEPFQAAALR |
Ga0127499_10187911 | 3300010141 | Grasslands Soil | MPLVGFRLLEGRAEPASANLSPVTRDYPSRARDDLFQA |
Ga0115593_12219641 | 3300010144 | Wetland | MPLDGLRRLEGKAAPVAASLSPVTRDYPSRALSGVFQAAALRLFY |
Ga0115593_13462472 | 3300010144 | Wetland | MPLVSFRRQEGRAAPAAANLSPVARDYPSRARVDLFQAAALRLF |
Ga0115593_13489231 | 3300010144 | Wetland | MPLVGFRLLEGRAEPASANHSPVTRDYPSRALGDHFRPPRFDC |
Ga0115593_13512971 | 3300010144 | Wetland | MPLNGLRRREGRATPVVAALSPVTREYPSRALSDVFQAAALRLF |
Ga0115593_13520191 | 3300010144 | Wetland | MPRVGFRRLEGMTEPASANHSPVTRDYPSRALSDVFQAAALRLF |
Ga0115593_13841291 | 3300010144 | Wetland | MPLDGLHRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALR |
Ga0126321_11815651 | 3300010145 | Soil | MPLVGFRLLEGRAEPASASLSPVTRDYPSRARVDLFQAAALRL |
Ga0126321_13099981 | 3300010145 | Soil | MPPIRLRVLEGRAEPASASHSPVARDYPSRARGDFFQAAA |
Ga0126319_10354501 | 3300010147 | Soil | MPRNRLSPMEGRAAPAAATHSPVTRDYPSRALGDVFQAAALRLF |
Ga0126354_12551081 | 3300010857 | Boreal Forest Soil | MPRVRLRVLEGRAAPVAASLSPVARDYPSRARVDLFQAAALR |
Ga0138111_11211152 | 3300010896 | Grasslands Soil | MPLVGFRRQEGRAAPAAANHSPVARDYPSRARVDLFQAAAL |
Ga0150983_135937611 | 3300011120 | Forest Soil | MPSGRFRSLEGRAAPAAANHSPVTRDYPSRAFGDLFQNHRAATV |
Ga0138293_1352491 | 3300011282 | Watersheds | MPLAGLRRLEGMSTPAVATHSPVTRDYPSRALSDVFQ |
Ga0126317_109981091 | 3300011332 | Soil | MPLVGFRLPEGRAEPASANHSPVTRDYPSRARVDLFQAAALRL |
Ga0127502_100269271 | 3300011333 | Soil | LPFRPLTRPKGRVAPAATNLSPVTRDYPSRAFSGVFQAPALRLF |
Ga0151652_104301651 | 3300011340 | Wetland | MPLVSFRRQEGRAAPAAAHLSPVARDYPSRARVDLFQAAALRL |
Ga0151652_108153901 | 3300011340 | Wetland | MPLVGFRRQEGRAAPAATHLSPVARDYPSRALSDVFQVAAL |
Ga0151652_125937041 | 3300011340 | Wetland | MPHNRLSPLEGRAAPAATHLSPVARDYPSRALNDVFQAAALRLF |
Ga0150985_1000934451 | 3300012212 | Avena Fatua Rhizosphere | MPLHRFRCREGKAAPVATLLSPVTRDYPSRARVDLFQAAALRLF |
Ga0150985_1106405151 | 3300012212 | Avena Fatua Rhizosphere | VPVKPLCGLKGRAAPAATNLSPVARDYPSRAFNGFFQAVALRLF |
Ga0150985_1161030561 | 3300012212 | Avena Fatua Rhizosphere | MPLVGFRRHEGRATPVVAIHSPVTRDYPNRALGGPFSTPHFDF |
Ga0134022_10262141 | 3300012371 | Grasslands Soil | MPLVGFRLLEGRVAPAATNLCPVTRDYPSRARVDLFQAAALRLF |
Ga0134022_11882961 | 3300012371 | Grasslands Soil | MPLSGFRRREGKATPVVANLSPVARDHPSRTLGEHFSSPR |
Ga0134037_11160821 | 3300012372 | Grasslands Soil | LPIIPLARLKGRVAPAATNLSPVTRDYPSRALSGVFQ |
Ga0134037_11446911 | 3300012372 | Grasslands Soil | MPLSGFRRREGKATPVVANLSPVARDHPSRTLGEHFSSPRR |
Ga0134039_11160881 | 3300012374 | Grasslands Soil | MPLVSFRLLEGRVAPAATNLCPVTRDYPSRARVDLFQAAALRL |
Ga0134029_12203751 | 3300012377 | Grasslands Soil | MPLVGFRRQEGRAAPAAAHLSPVARDYPSRARVDLFQAAALRLF |
Ga0134025_11513181 | 3300012378 | Grasslands Soil | MPLVGFRRQEGRAAPAATTLSPVTRDYPSRARVDLFQAAALRL |
Ga0134025_11681571 | 3300012378 | Grasslands Soil | MPLSGFRRREGKATPVVANLSPVARDHPSRTLGEHFSSPRRD |
Ga0134047_10188822 | 3300012380 | Grasslands Soil | MPLVGLRRQEGRATPVVASLSPVARDYPSRALSDVFQAAALRLFY |
Ga0134047_10609721 | 3300012380 | Grasslands Soil | LPFTPLARLKGRAAPAATNLSPVARDYPSRACSGVFQAPALRLF |
Ga0134047_10736221 | 3300012380 | Grasslands Soil | MPLAGFRRQEGRAAPAAANHSPVARDYPSRARVDLFQAAALRLF |
Ga0134047_11198671 | 3300012380 | Grasslands Soil | MPRGRFRALEGKVAPAATIHSPVARDYPSRARVDLFQAAALRL |
Ga0134033_12062061 | 3300012383 | Grasslands Soil | MPLVGFRLQEGTAEPASANHSPVTRDYPSRARVDLFQAAALRL |
Ga0134036_10931541 | 3300012384 | Grasslands Soil | MPLAGFRRQEGKATPVVAALSPVTRDYPSRAFSEHFSPPCCDC |
Ga0134023_10440051 | 3300012385 | Grasslands Soil | MPLVGFRLQEGRAEPASANHSPVTRDYPSRARVDLFQAAALRLF |
Ga0134046_10774091 | 3300012386 | Grasslands Soil | MPLVGFRRLEGRAAPAATHLSPVTRDYPSRARSDVFQAAALRLF |
Ga0134030_10421311 | 3300012387 | Grasslands Soil | MPLVGFRRQEGRAAPAATTLSPVTRDYPSRARVDLFQAAALR |
Ga0134054_11337791 | 3300012390 | Grasslands Soil | MPLVGFRLLEGRAEPASANHSPVTRDYPSRARDDLFQAATLRLF |
Ga0134054_12489471 | 3300012390 | Grasslands Soil | LPIEPLARLKGRVAPAATNLSPVARDYPSRALSGVFQ |
Ga0134043_11097021 | 3300012392 | Grasslands Soil | MPLVGFRRQEGRAAPAAANHSPVARDYPSRARVDLFQAAALRLF |
Ga0134043_12620651 | 3300012392 | Grasslands Soil | MPRGRFRALEGKVAPAATIHSPVARDYPSRARVDLFQAAAL |
Ga0134057_11138971 | 3300012396 | Grasslands Soil | LPIIPLARLKGRVAPAATNLSPVTRDYPSRALSGVFQAPALRLFY |
Ga0134051_12979971 | 3300012398 | Grasslands Soil | MPLVGFRRLEGRAAPAATHLSPVTRDYPSRARSDVFQAAALRL |
Ga0134051_13686582 | 3300012398 | Grasslands Soil | MPLVGLRRQEGRATPVVASLSPVTRDYPSRALNEVFQSAALRLF |
Ga0150984_1147871941 | 3300012469 | Avena Fatua Rhizosphere | MPLHSFRCREGRAAPVATNLSPVTRDYPSRARVDLFQAAALRLF |
Ga0157610_11898251 | 3300012725 | Freshwater | MPLAGLRRLEGRTTPAVAAHSPVTRDYPSRALSDVFQVAALR |
Ga0138289_11508151 | 3300012763 | Freshwater Lake | MPHNRLSPLEGGAAPAAAHLSPVARDYPSRALSDVFQAAALRLF |
Ga0138287_11490391 | 3300012772 | Freshwater Lake | MPHNRLSPLEGGAAPAAAHLSPVARDYPSRALSDVFQAAALRL |
Ga0157298_101789531 | 3300012913 | Soil | MPLVGFRRQEGRVEPASTHLSPVTRDYPSRARVDSFQAAALRLFYQGTTATVPA |
Ga0129337_13765871 | 3300012968 | Aqueous | MPPDGLRRPEGRATPAVATLSPVTRDHPSRALNGVFQAVAL |
Ga0129338_11563281 | 3300012970 | Aqueous | MPPSGLRRSEGRATPAVAILSPVTRDHPSRALNGVFQAVALRL |
Ga0154014_1338501 | 3300013052 | Corn, Switchgrass And Miscanthus Rhizosphere | LPITPLARLKGRVAPAATNLSPVARDYPSRALSGVFQAPALRLF |
Ga0153914_10915541 | 3300013078 | Freshwater Wetlands | MPPGGLRRSEGRAKPAFAIHSPVARDYPSRALNGVFQAV |
Ga0153913_11156451 | 3300013080 | Freshwater Wetlands | MPPDGLHRTEGRATPAVAILSPVTRDYPSRALSDVFQAAALRLF |
Ga0170791_106214141 | 3300013295 | Freshwater | MPRDDSRRLEGRATPAVTTHSPVTRDYPSRALSDVFQAAALRLF |
Ga0163163_132615951 | 3300014325 | Switchgrass Rhizosphere | LPIKPLARLKGRVAPAATNLSPVTRDYPSRALSGVFQAPALRLFYQG |
Ga0187789_11521452 | 3300019199 | Peatland | MPLNGLRRLEGMATPAVATLSPVARDYPSRALSGVFQAAALR |
Ga0187789_12190751 | 3300019199 | Peatland | MPLSGLRRHEGRATPVVADLSPVARDYPSRALGDHFRSPHYDC |
Ga0187789_12593801 | 3300019199 | Peatland | MPPGGLHRSEGTATPVAAIHSPVTRDYPSRALSGVFQAVALRLF |
Ga0187789_12802651 | 3300019199 | Peatland | MPLAGLRRREGRAAPVAASHSPVARDYPSRALGNHFRSAALRLF |
Ga0180032_11404081 | 3300019201 | Estuarine | MPLNGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRLF |
Ga0179938_12182331 | 3300019210 | Anaerobic Digestor Sludge | MPPGGLHRSEGRAKPAFAIHSPVARDYPSRALNGVFQAVALRLF |
Ga0180106_12567151 | 3300019212 | Groundwater Sediment | MPLVGFRRQEGRATPVVATLSPVARDYPSRALSDVFQAAALRLF |
Ga0179939_10043281 | 3300019216 | Anaerobic Digestor Sludge | MPLDGLRRLEGRTAPAAIRLSPVARDYPSRALSGMSQAAAPR |
Ga0179939_10369951 | 3300019216 | Anaerobic Digestor Sludge | MPLDGLRRLEGRMAPAAIRHSPVARDYPSRALSGVFQTAAPRLF |
Ga0180119_12194911 | 3300019228 | Groundwater Sediment | MPLDGFRRLEGRATPVVASHSPVARDYPSRALSDVFQAAALRL |
Ga0180119_12203081 | 3300019228 | Groundwater Sediment | MPLVGFRRQEGRAAPAAASLSPVARDYPSRALSDVFQAAALRL |
Ga0180116_10379631 | 3300019229 | Groundwater Sediment | MPLTDFRHWEGRTAPVAATLSPVTRDYPSRAHSDVFQAAA |
Ga0180116_10818451 | 3300019229 | Groundwater Sediment | MPLVSFRRQEGRAAPAAARLSPVARDYPSRARVDLFQAAALRLF |
Ga0180116_11357471 | 3300019229 | Groundwater Sediment | MPLDDFRRQEGRVAPAATSLSPVARDYPNRARVDLFQAAALRL |
Ga0180114_10000851 | 3300019232 | Groundwater Sediment | MPLGGFRRLEGRATPVVASLSPVARDYPSRALSDVFQAAALRLF |
Ga0180114_11618381 | 3300019232 | Groundwater Sediment | MPLNNLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALR |
Ga0180114_12861292 | 3300019232 | Groundwater Sediment | MPLVGFRRQEGRAAPAADSLSTIVRDYPSRALSHGFQAVAL |
Ga0180114_13258401 | 3300019232 | Groundwater Sediment | MPLVRFRVLEGRATPVVASLSPVARDYPSRARVDLLPAAALRLF |
Ga0184645_10330621 | 3300019233 | Groundwater Sediment | MPLVGLRRLEGRVAPAATNLSPVARDYPSRARSDVFQAAALRLF |
Ga0184645_11508591 | 3300019233 | Groundwater Sediment | MEGRAAPAAASLSPVTRDYPSRARVDLFQAAALRLF |
Ga0184645_11762921 | 3300019233 | Groundwater Sediment | MPRVGFRLLEGWAEPASANHSPVTRDYPSRARVDLFQAAALRL |
Ga0184645_13103882 | 3300019233 | Groundwater Sediment | MPLVGLRLQEGRATPVVASHSPVTRDYPSRALSDVFQAAALRLF |
Ga0172288_11227941 | 3300019234 | Wetland | MPLVGLRRLEGMATPAVATHSPVTRDYPSRALSGVFQAA |
Ga0172288_11315141 | 3300019234 | Wetland | MPPGGLRRSEGRAKPAFAIHSPVARDYPSRALNGVFQAVALRLF |
Ga0179944_12659881 | 3300019236 | Anaerobic Digestor Sludge | MPPGGLHRSEGRAKPAFAIHSPVARDYPSRALNGVFQAVALRL |
Ga0180112_13248392 | 3300019238 | Groundwater Sediment | MPLDGLRRMEGRATPAVAIHSPVTRDYPSRAHSDVFQAAALRLF |
Ga0180112_13263261 | 3300019238 | Groundwater Sediment | MPLNNLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRLF |
Ga0181510_10111941 | 3300019240 | Peatland | LCLPTVARLKGRAAPAAAYLSPVARDYLSRAHVGVFQTAALRLF |
Ga0187793_14225701 | 3300019241 | Peatland | LEGLAAPAATSHSPVTRDYLSRARVDMFQAAALRLF |
Ga0180111_10023032 | 3300019244 | Groundwater Sediment | MPLIGFRRREGRATPVVATLSPVARDYPSRALSDVFQAAALRLF |
Ga0180111_10827301 | 3300019244 | Groundwater Sediment | MPLVRFRVLEGRATPIVANLSPITRNYPSRALGNHFQVLR |
Ga0187791_11962361 | 3300019245 | Peatland | MPPGGLHRSEGKATPAAAIHSPVTRDYPSRALNGVFQAVALRLF |
Ga0187791_12153141 | 3300019245 | Peatland | MPILGLRRLKGRATPAVAVHSPVTRDYPSRAFSDVFQAAALRL |
Ga0187791_12699021 | 3300019245 | Peatland | MPPGGLHRSEGTATPVAAIHSPVTRDYPSRALSGVFQAVALRL |
Ga0187791_13155901 | 3300019245 | Peatland | MCLSRGFRRREGKAEPASANLSPVARDYPSRARVDLFQAAALRLF |
Ga0172287_11398701 | 3300019246 | Wetland | MPLVGLRRLEGMATPAVATHSPVTRDYPSRALSGVFQAAALRLF |
Ga0172287_12640991 | 3300019246 | Wetland | MPCSGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAA |
Ga0172287_13913761 | 3300019246 | Wetland | MPFVGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRLF |
Ga0172287_13918071 | 3300019246 | Wetland | MPLIGLRRLEGMATPAVAIHSPVTRDYPSRALSDVFQAAALRLF |
Ga0180117_12296101 | 3300019248 | Groundwater Sediment | MPLVGFRRQEGRATPVVATLSPVARDYPSRALSDVFQAAALRL |
Ga0180117_14219311 | 3300019248 | Groundwater Sediment | MPLGSFRRQEGRATPVVASLSPVARDYPSRALSDVFQAAA |
Ga0184648_12498031 | 3300019249 | Groundwater Sediment | MPLDGLHRLEGRATPVVANHSPVARDYPSRALSDVFQAAALRLF |
Ga0187790_10440941 | 3300019250 | Peatland | MPPGGLHRSEGKATPAAAIHSPVTRDYPSRALNGVFQAVALRL |
Ga0187790_10631061 | 3300019250 | Peatland | MPRSSLRRLEGMTTPAVATHSPVTRDYPSRALSGVFQAAVLRLF |
Ga0187790_12419931 | 3300019250 | Peatland | MPILGLRRLKGRATPAVAVHSPVTRDYPSRAFSDVFQAAALRLF |
Ga0187790_12488052 | 3300019250 | Peatland | MPAGRFRSLEGRAAPAAAHHSPVTRDYPSRAFGDLF |
Ga0172286_11057301 | 3300019252 | Wetland | MPFNGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRLF |
Ga0184641_13146331 | 3300019254 | Groundwater Sediment | MPRRRLAPLEGKAAPVAASLSPVARDYPSRAHSDVFQAAALRLF |
Ga0184643_11880711 | 3300019255 | Groundwater Sediment | MPLVSFRCQEGRTTPVVATLSPVARDYPSRALSDVFQAAA |
Ga0184646_10904611 | 3300019259 | Groundwater Sediment | MPLTDFRHWEGRTAPVAATLSPVTRDYPSRAHSDVFQAAALRL |
Ga0187792_10134081 | 3300019265 | Peatland | MPLDRYRDLEGRVAPAATNLSPVTRDYPSRARVDLFQAAALRLF |
Ga0187792_12427671 | 3300019265 | Peatland | LRAYEGKTAPVAASLSPVTRDYPSRARAGMFQAAALRLF |
Ga0184644_15972821 | 3300019269 | Groundwater Sediment | MPLVSFRLLEGWAEPASANHSPVTRDYPSRARVDLFQAAALRLF |
Ga0180107_13202871 | 3300020064 | Groundwater Sediment | MPLVGFRRQEGRAAPAAANLSPVARDYPSRARVDLFQAAALRL |
Ga0180108_10933251 | 3300020066 | Groundwater Sediment | MPLVGFRRLEGMAEPASANHSPVTRDYPSRALSDVFQAAALRLF |
Ga0180109_10186141 | 3300020067 | Groundwater Sediment | MPLDGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRL |
Ga0180109_14770491 | 3300020067 | Groundwater Sediment | MPFVRFRVLEGRATPVVASLSPVARDYPSRALGNHFQVL |
Ga0206356_112443191 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | LPFTPLARLKGRVAPAATNLSPVARDYPSRACSGVFQAPALRL |
Ga0206352_104587571 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | LPFTPLARLKGRAAPAATNLSPVARDYPSRACSGVFQALALRLF |
Ga0206354_104081511 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LPVIPLARLKGRVAPAATNLSPVARDYPSRALSGVFQAPALRLF |
Ga0210329_1276451 | 3300021257 | Estuarine | MPRYDLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRLF |
Ga0210345_1523381 | 3300021258 | Estuarine | MPLGGSRRSEGRATPAVAIHSPVTRDYPSRALSDVFQAAA |
Ga0179581_1142301 | 3300021259 | Vadose Zone Soil | MPLVGFRLLEGRAEPASANHSPVTRDYPSRARVDLFQAAALRL |
Ga0210343_1485381 | 3300021263 | Estuarine | MPLGDLRRSEGKATPAVAIHSPVTRDYPSRALSNVFQAAALRLF |
Ga0210340_10374181 | 3300021273 | Estuarine | MPLVGFRRQEGRAAPAATRLSPVARDYPSRALSDVFQAAA |
Ga0210340_11254411 | 3300021273 | Estuarine | MPLVGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQVAALR |
Ga0210340_11278121 | 3300021273 | Estuarine | MPLDGFHRLEGRATPVVANHSPVARDYPSRALSDVFQ |
Ga0210332_1254911 | 3300021278 | Estuarine | MPLGDLRRSEGKATPAVAIHSPVTRDYPSRALSNVFQAAALRL |
Ga0210357_10235491 | 3300021283 | Estuarine | MPLDDLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQ |
Ga0179583_10555331 | 3300021286 | Vadose Zone Soil | MPLVGFRRQEGRAAPAAANLSPVARDYPSRALSDVFQAAALRL |
Ga0210355_10123701 | 3300021292 | Estuarine | MPLDDLRRLEGMATPAVAIHSPVTRDYPSRALSDVFQAAALRLF |
Ga0210325_11266351 | 3300021294 | Estuarine | MPLDDLRRLEGMATPAVAIHSPVTRDYPSRALSDVFQAAALRL |
Ga0179585_11451381 | 3300021307 | Vadose Zone Soil | MPAVCLRIPQGRAAPAAADLSPVARDYPSRALSDVFQAAALRLLPQ |
Ga0179958_11821991 | 3300021315 | Vadose Zone Soil | MPLVGFRLLEGRAEPASANHSPVTRDYPSRARVDLFQAAALRLF |
Ga0210362_10850281 | 3300021329 | Estuarine | MPLDDLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQVAALRLF |
Ga0210362_12560891 | 3300021329 | Estuarine | MPRNGFRHLEGRATPAVAIHSPVTRDYPSRALSDVFQVAALRLF |
Ga0210362_12977201 | 3300021329 | Estuarine | MPRYDLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRLFY |
Ga0210362_13123901 | 3300021329 | Estuarine | MPLDGFHRLEGRATPVVANHSPVARDYPSRALSDVFQAAALRLF |
Ga0210363_12859531 | 3300021330 | Estuarine | MPLGDLRRSEGKATPAVAIHSPVTRDYPSRALSNVFQAAALR |
Ga0210339_10330761 | 3300021332 | Estuarine | MPRNGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQ |
Ga0210324_10618661 | 3300021333 | Estuarine | MPLGGFHRLEGMATPVVANLSPVARDYPSRALSDVFQAAALRLF |
Ga0210324_13795081 | 3300021333 | Estuarine | MPLVGFRRQEGRAAPAATHLSPVARDYPSRALSDVFQAAALRLF |
Ga0210323_10000512 | 3300021853 | Estuarine | MPLAGLRRLEGMSTPAVATHSPVTRDYPSRALSDVFQVAALRLF |
Ga0210323_10301931 | 3300021853 | Estuarine | MPSIGLRRLKGRATPAVAIHSPVTRDYPSRALSDVFQAAALRLF |
Ga0210323_10313421 | 3300021853 | Estuarine | MPLAGLRRLEGRATPVVAIHSPVTRDYPSRALSDVFQAAALRLF |
Ga0210323_10338211 | 3300021853 | Estuarine | MPLVGFRRQEGRAAPAATHLSPVARDYPSRALSDVFQAAALR |
Ga0210323_11006331 | 3300021853 | Estuarine | MPLVGFRRQEGRAAPAATRLSPVARDYPSRALSDVFQ |
Ga0213849_10576171 | 3300021857 | Watersheds | VRYACQNRYRGLEGKAAPVAASLSPVTRDYPSRASSGVFQAAALRLFY |
Ga0213849_12731721 | 3300021857 | Watersheds | MPLVSFRRQEGRAAPAAANLSPVARDYPSRARVDLFQAA |
Ga0213845_10136022 | 3300021929 | Watersheds | VRYACQNRYRGLEGKAAPVAASLSPVTRDYPSRASSGVFQAAALRLF |
Ga0213847_12374082 | 3300021938 | Watersheds | MPLVGFRRQEGKAAPAAANLSPVARDYPSRARVDLFQAAALRLFYQG |
Ga0213847_12376511 | 3300021938 | Watersheds | MPRVGFRRLEGMAEPASANHSPVTRDYPSRALSDVFQAAALRL |
Ga0213856_10701472 | 3300021947 | Watersheds | MPLIGFRRREGRATPVVASLSPVARDYPSRALSDVFQAAALRLF |
Ga0213856_11710881 | 3300021947 | Watersheds | MPLVGFRRQEGMAAPAAANLSPVARDYPSRALSDVFQAAALRL |
Ga0213856_12656911 | 3300021947 | Watersheds | MPLDRSRGLEGRAAPAAASHSPVARDYPSRALSGVFQAPALRLLPQR |
Ga0222624_11701821 | 3300021951 | Groundwater Sediment | MPLVSFRRQEGRAAPAAANLSPVARDYPSRALSDVFQAAALRLF |
Ga0213933_1272061 | 3300022141 | Freshwater | MPLAGLRRLEGMSTPAVATHSPVTRDYPSRALSDVFQV |
Ga0213929_10108641 | 3300022154 | Freshwater | MPLDGLRRLEGLTTPAVAIHSPVTRDYPSRALSGVFQAAALRLF |
Ga0213929_10146891 | 3300022154 | Freshwater | MPLVGFRRQEGKAAPAAAYLSPVARDYPSRARVDLFQAAALRL |
Ga0213934_10297111 | 3300022156 | Freshwater | MPLAGLRRLEGTATPAVAIHSPVTRDYPSRALSGVFQAAAL |
Ga0213934_10416581 | 3300022156 | Freshwater | MPLVGFRRQEGRAAPAATRLSPVARDYPSRALNDVFQAAALRLF |
Ga0079039_15808291 | 3300022185 | Freshwater Wetlands | MPAFRFRFQEGTAAPVAASLSPVARDYPSRARDGIFQAAALRLF |
Ga0222625_10704611 | 3300022195 | Groundwater Sediment | MPLVGFRRQEGKATPVVASLSPVARDYPSRALSDVFQAAALRLF |
Ga0210346_1207071 | 3300022368 | Estuarine | MPLDDLRRLEGMATPAVAIHSPVTRDYPSRALSDVFQAAALR |
Ga0210319_10099741 | 3300022373 | Estuarine | MPLDDLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAA |
Ga0210376_10480811 | 3300022385 | Estuarine | MPRNGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAA |
Ga0242641_10152241 | 3300022499 | Soil | MPSGRFRSLEGRAAPAAANHSPVTRDYPSRARGDLFQNHRAA |
Ga0242668_10384161 | 3300022529 | Soil | MPSGRFRSLEGRAAPAAANHSPVTRDYPSRARGDLFQNHRAATV |
Ga0242670_10204901 | 3300022708 | Soil | VIVPFSFLAEWKGRVAPAAAFLSPVARDYPSRAFGGFFSPPRLD |
Ga0242677_10570611 | 3300022713 | Soil | MPSGRFRSLEGRAAPAAANHSPVTRDYPSRAFGDLFQNH |
Ga0242675_10319202 | 3300022718 | Soil | VICACRDRFRSQEGRAAPAAAFHSPVTRDYPSRALGDLFQIAALA |
Ga0242666_10915671 | 3300022721 | Soil | MPSGRFRSLEWRAAPAAANHSPVTRDYPSRARGDLFQNH |
Ga0228705_1059251 | 3300023546 | Freshwater | MPLVGSRRQEGKAAPAAAYLSPVARDYPSRFRVDLFQAA |
Ga0228707_10281661 | 3300023700 | Freshwater | MPRAGLRRLEGMTTPAVATHSPVTRDYPSRALNDVFQAAALRL |
Ga0228708_10303751 | 3300023703 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRLF |
Ga0228709_10542411 | 3300023708 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRLFY |
Ga0228709_11212301 | 3300023708 | Freshwater | MPLAGLRRLEGRATPAVAIHSPVTRDYPSRALSDVF |
Ga0255223_11014221 | 3300024480 | Freshwater | MPLVGFRHREGRAAPAATFRSPVARDYLSRAFSDVFQAAAPR |
Ga0256330_11025571 | 3300024481 | Freshwater | MPLNGLRRLEGRATPAAANHSPVTRDYPSRALSDVFQA |
Ga0255224_10592871 | 3300024483 | Freshwater | MPLNGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAA |
Ga0256318_11169981 | 3300024485 | Freshwater | MPLAGLRRLEGRTTPAAAAHSPVTRDYPSRALSDVFQAAALR |
Ga0255164_10304952 | 3300024495 | Freshwater | MPGRGLRRVEGRAAPVAAFLSPVAREYPSRALSGVFQAAAPRLFYQGTRQRVSALVRNE |
Ga0256322_10456892 | 3300024530 | Freshwater | MPLNGLRRLEGRATPAVANHSPVTRDYPSRALSGVFQAAALR |
Ga0256322_10484681 | 3300024530 | Freshwater | MPLAGLRRLEGRTTPAVAAHSPVTRDYPSRALSDVFQAAALRLFTHE |
Ga0255228_10531571 | 3300024531 | Freshwater | MPLVGFRHREGRAAPAATFRSPVARDYLSRAFSDVFQAAAPRL |
Ga0256357_10545771 | 3300024534 | Freshwater | MPLAGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRL |
Ga0256357_10973191 | 3300024534 | Freshwater | MPRVGLRRLEGVAEPASANHSPVTRDYPSRALSDVFQAAALRLF |
Ga0255303_10525381 | 3300024535 | Freshwater | MPLAGLRRLEGRATPAVADLSPVTRDYPSRALSDVFQAAALRL |
Ga0256338_11608182 | 3300024536 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRLFT |
Ga0255300_10411841 | 3300024540 | Freshwater | MPLAGLRRLEGRATPAVADLSPVTRDYPSRALSDVFQAAALRLFYHE |
Ga0256350_10466002 | 3300024542 | Freshwater | MPLAGLRRLEGRATPAVADLSPVTRDYPSRALSDVFQAAALR |
Ga0256350_10576681 | 3300024542 | Freshwater | MPRVGLRRLEGMAEPASAIHSPVTRDYPSRALSDVFQAAALRL |
Ga0256348_10384712 | 3300024543 | Freshwater | MPRVGFRRLEGRAEPASAIHSPVTRDYPSRALSDVFQAAALR |
Ga0256348_10458211 | 3300024543 | Freshwater | MPLAGLRRLEGRATPAVADLSPVTRDYPSRALSDVFQAAALRLLPQ |
Ga0255294_10519871 | 3300024544 | Freshwater | MPRVGLRRLEGVAEPASANHSPVTRDYPSRALSDVFQAAA |
Ga0255294_10734351 | 3300024544 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRLFYQGTV |
Ga0255294_10879541 | 3300024544 | Freshwater | MPLAGLRRLEGRATPAVADLSPVTRDYPSRALSDVFQAAALRLF |
Ga0256356_10823431 | 3300024546 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAA |
Ga0255292_10887791 | 3300024547 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRLFYHES |
Ga0256345_10504771 | 3300024552 | Freshwater | MPLNGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRLFTH |
Ga0255301_10775991 | 3300024553 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFHATAPR |
Ga0255283_10690132 | 3300024557 | Freshwater | MPLVGFRGREGKAAPAATFRSPVSRDYLSRAFSDFFQAAA |
Ga0255284_10609771 | 3300024559 | Freshwater | MPLNGLRRLEGRATPAAANHSPVTRDYPSRALSDVFQAAALRL |
Ga0255243_10765971 | 3300024569 | Freshwater | LRDVEGTTEPASIVLSPVARDYPSRALSGVFQASALRLFHEI |
Ga0255276_10983842 | 3300024570 | Freshwater | MPLNGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRLFT |
Ga0255268_11377161 | 3300024572 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRLFYQGT |
Ga0256312_11445221 | 3300024861 | Freshwater | MPLAGLRRLEGRTTPAAAAHSPVSRDYPSRALSDVFQAAALRLF |
Ga0255271_11276411 | 3300024864 | Freshwater | MPLVGFRHREGRAAPAATFRSPVARDYLSRAFSDVF |
Ga0255245_10228661 | 3300025744 | Freshwater | MPLVGFRLLEGRAEPASATHSPVARDYPSRALNDV |
Ga0255245_10338611 | 3300025744 | Freshwater | MPLAGLRRLEGRTTPAVVAHSPVTRDYPSRALSDVFQ |
Ga0256314_10288681 | 3300025749 | Freshwater | MPLAGLRRLEGRTTPAVAAHSPVTRDYPSRALGGVFQAPALRLF |
Ga0255249_10469091 | 3300025760 | Freshwater | MPLAGLRRLEGRTTPAVVAHSPVTRDYPSRALSDVFQVAALRL |
Ga0213907_1208972 | 3300026384 | Enriched Soil Aggregate | MPLVGFRRQEGRATPVVATLSPVARDYPSRALSDVFQAAALR |
Ga0255304_10511231 | 3300026402 | Freshwater | MPRVGLRRLEGVAEPASANHSPVTRDYPSRALSDVFQAAALR |
Ga0256326_10317862 | 3300026412 | Freshwater | MPLNGLRHLEGRATPAVANHSPVTRDYPSRALSDVFQAAALR |
Ga0256298_10487701 | 3300026415 | Freshwater | MPLVGFRRQEGRAAPAATRLSPVARDYPSRALNDVFQAAALR |
Ga0255253_10627011 | 3300026429 | Freshwater | MPLNGLRHLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRL |
Ga0255253_10692751 | 3300026429 | Freshwater | MPLAGLRRLEGRTTPAVVAHSPVTRDYPSRALSDVFQVAALR |
Ga0256364_10485952 | 3300026444 | Freshwater | MPRVGFRRLEGMAEPASANHSPVTRDYPSRALSDVFQAAALR |
Ga0256319_10542751 | 3300026454 | Freshwater | MPLAGLRRLEGRTTPAAAAHSPVTRDYPSRALSDV |
Ga0256355_10449991 | 3300026563 | Freshwater | MPLNGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAA |
Ga0256334_10968851 | 3300026566 | Freshwater | MPLNGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALR |
Ga0255240_10673941 | 3300026568 | Freshwater | MPLNGLRRLEGRATPAVANHSPVTRDYPSRALSDVFQAAALRL |
Ga0255289_11159251 | 3300026571 | Freshwater | LPRSDLRRLEGRATPAVAFHSPVTRDYPSRALSGVFQAAALRL |
Ga0255289_11170451 | 3300026571 | Freshwater | MPLVGFRLREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRLFY |
Ga0255269_11639161 | 3300026573 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRL |
Ga0255075_10614441 | 3300027578 | Freshwater | MPLVGFRHREGRAAPAATFRSPVARDYLSRAFSDVFQ |
Ga0256323_10544321 | 3300028077 | Freshwater | MPLAGLRLREGRTTPAVAAHSPVTRDYPSRALGGAFQAPA |
Ga0255299_10570152 | 3300028089 | Freshwater | MPLVGLRLLEGRAEPASATHSPVARDYPSRALSDVFQAAALRLF |
Ga0255261_10307951 | 3300028097 | Freshwater | VPPAGFRRLEGRAAPAATLHSPVARDYPSRAFSDVFQAAAPRLFY |
Ga0256363_10441351 | 3300028100 | Freshwater | MPRVGLRRLEGVAEPASANHSPVTRDYPSRALSDVFQAAALRL |
Ga0256349_10394821 | 3300028101 | Freshwater | MPRVGFRRLEGRAEPASANHSPVTRDYPSRALSDVFQAAALRL |
Ga0256305_10750151 | 3300028108 | Freshwater | LRDVEGTTEPASIVLSPVARDYPSRALSGVFQASALRLFYQGNQE |
Ga0256335_11526261 | 3300028112 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRLFYQ |
Ga0255234_11448361 | 3300028113 | Freshwater | MPLVGFRRREGKAAPAATFRSPVARDYLSRAFSDVFQAAAPRLFYQGTG |
Ga0255291_1009851 | 3300028116 | Freshwater | MPLAGLRRLEGRATPAVADLSPVTRDYPSRALSGVFQAAALRLF |
Ga0255290_1020701 | 3300028117 | Freshwater | MPLAGLRRLEGRATPAVANHSPVTRDYPSRALNDVFQAA |
Ga0256351_1036311 | 3300028118 | Freshwater | MPLAGLRRLEGRATPAVADLSPVTRDYPSRALSDVFQAAA |
Ga0255226_10408291 | 3300028255 | Freshwater | MPLDGFHRLEGRATPVVANHSPVARDHPSRALSDVFQAAALR |
Ga0255257_10620351 | 3300028257 | Freshwater | MPLAGLRRLEGRTTPAVAAHSPVTRDYPSRALSDVFQAAALRL |
Ga0256316_10801931 | 3300028261 | Freshwater | MPLAGLRRLEGRTTPAVAAHSPVTRDYPSRALSDVFQVAALRL |
Ga0256358_10558751 | 3300028267 | Freshwater | MPLAGFRRLEGRAAPAAADLSPVTRDYPSRALGDVFQVPALRL |
Ga0255256_10498231 | 3300028271 | Freshwater | MPLAGLRLREGRATPAVAAHSPVTRDYPSRALGGVFQAPAL |
Ga0257136_10433411 | 3300028619 | Marine | MPLDGLRRLEGKATPVVASLSPVTRDYPSRALSGVFQAA |
Ga0257136_10484041 | 3300028619 | Marine | MPRNGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRLF |
Ga0257142_10431531 | 3300028621 | Marine | MPLDGLRRLEGKATPVVASLSPVTRDYPSRALSGVFQAAALRLF |
Ga0257141_10456281 | 3300028623 | Marine | MPRDGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRL |
Ga0272412_11991542 | 3300028647 | Activated Sludge | MPPDGLHRLEGRATPAVANLSPVARDYPSRAFSGVFQAVALRVLPQR |
Ga0272412_12601341 | 3300028647 | Activated Sludge | MPLDGLRRLEGRTAPAAIRHSPVARDYPSRALSGVSQAAAPRLF |
Ga0265597_1016761 | 3300029639 | Marine | MPRNGLRRLEGRATPAVAIHSPVTRDYPSRALSNIFQTTALR |
Ga0265604_1156571 | 3300029674 | Marine | MPLDGLRRLEGKATPVVASLSPVTRDYPSRALSGVFQAAALRL |
Ga0265604_1163261 | 3300029674 | Marine | MPLDGLHRLEGRTTPAVAIHSPVTRDYPSRALSGVFQAAALRLF |
Ga0265604_1163801 | 3300029674 | Marine | MPRNGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRL |
Ga0265603_10185562 | 3300029685 | Marine | MPRDGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRLFYQGTR |
Ga0265603_10294621 | 3300029685 | Marine | MPFDGLRRLEGRATPAVATHSPVTRDYPSRALSGVFQAAALRLF |
Ga0265598_10309352 | 3300029691 | Marine | MPRNGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRLFYQG |
Ga0247654_11820251 | 3300030552 | Soil | MPLTGFRQWEGTATPVVAALSPVARDYPSRALSDVFQAAA |
Ga0247659_11486321 | 3300030600 | Soil | MPLVGFRRLEGRAEPTSANHSPVTRDYPSRARVDLFQAAARR |
Ga0247655_100490951 | 3300030621 | Soil | MPLVGFRRLEGRVAPAATNLSPVARDYPSRARSDAFQAAALRLFYQG |
Ga0247629_102768831 | 3300030628 | Soil | MPLVGFRRLEGRAEPASANHSPVTRDYPSRARVDLFQAAALRLFYQ |
Ga0308203_10443851 | 3300030829 | Soil | MPLVGFRRREGRAAPAAANLSPVARDYPSRALSDVFQAAA |
Ga0308203_10922372 | 3300030829 | Soil | MPLVGFRRQEGRAAPAAANLSPVARDYPSRALSDVFQAAALRLF |
Ga0308152_1106111 | 3300030831 | Soil | MPLGGFRRQEGRATPAVAYLSPVARDYPSRALNDVFQAAALRLF |
Ga0308202_10646471 | 3300030902 | Soil | MPLVGFRRQEGEAAPAAANLSPVARDYPSRARSDVFQAAALRLF |
Ga0308202_11365781 | 3300030902 | Soil | MPLVGFHRLEGRAAPAAAYLSPVARDYPSRALSDVFQAAALRL |
Ga0308206_10542211 | 3300030903 | Soil | MPLVGFRLLEGRAEPASANHSPVTRAYPSRARVDLFQAAALRL |
Ga0308206_11021681 | 3300030903 | Soil | MPLVGFHRLEGRAAPAAAYLSPVARDYPSRALSDVFQAAALRLF |
Ga0308206_11315731 | 3300030903 | Soil | MPLVSFRCQEGRTTPVVATLSPVARDYPSRALSDVFQAAALRLF |
Ga0308206_11960022 | 3300030903 | Soil | MPRNWLSPLEGRATPVVASLSPVARDYPSRALSDVFQAAALRLF |
Ga0308206_11986771 | 3300030903 | Soil | MPLVSFRRQEGRATPVVASLSPVARDYPSRALSDVFQAAALRLF |
Ga0308198_10271551 | 3300030904 | Soil | MPLIGFRRREGRATPVVSSLSPVARDYPSRALSDVFQAAALR |
Ga0308198_10404481 | 3300030904 | Soil | MPLVGFRRQEGRAAPAAANLSPVARDYPSRALNDVFQAAALRLF |
Ga0308198_10417521 | 3300030904 | Soil | MPLGGFRRQEGRATPAVAYLSPVARDYPSRALNDVFQAAALR |
Ga0308198_10442091 | 3300030904 | Soil | MPLVGFRLLEGRAEPASATLSPVTRDYPSRARDDLFQAAALRL |
Ga0308200_11203522 | 3300030905 | Soil | MPLVDFRRLEGRATPVVASLSPVARDHPSRALSDVFQAAALRLF |
Ga0308183_11218661 | 3300030988 | Soil | MPLVGFRRQEGRAAPAAATLSPVARDYPSRALSDVFQAAALRLF |
Ga0308196_10265721 | 3300030989 | Soil | MQGRSEPASVRLSPVARDYPSRARSGVFQAAALRLF |
Ga0308178_10618941 | 3300030990 | Soil | MPLVGFRLLEGRAEPASANHSPVTRDYPSRARVDLFQAAAL |
Ga0073997_100733622 | 3300030997 | Soil | MPLVGFRRQEGRAAPAAANLSPVARDYPSRALSDVFQ |
Ga0073978_16282172 | 3300031036 | Marine | MPLVGFRHREGRAAPAATFRSPVARDYLSRAFSDVFQAAAPRLF |
Ga0308189_103492722 | 3300031058 | Soil | MPLVGFRRQEGRAAPAAAHLSPVARDYPSRALSDVFQAAALRLF |
Ga0308192_10734021 | 3300031082 | Soil | MPLVGFRRQEGMAAPAATNLSPVARDYPSRALSDVFQAAALR |
Ga0308201_102988562 | 3300031091 | Soil | MPLVDFRRLEGRATPVVASLSPVARDHPSRALSDVFQAAALR |
Ga0308204_103205392 | 3300031092 | Soil | MPHNWLSPLEGKATPVVASLSPVARDYPSRALSDVFQAAALRLF |
Ga0308197_100938951 | 3300031093 | Soil | MPLIGFRRREGRATPVVATLSPVARDYPSRALSDVFQAAALR |
Ga0308199_10779081 | 3300031094 | Soil | MPLIGSRRREGRATPVVASLSPVARDYPSRALSDVFQAAA |
Ga0308199_10800372 | 3300031094 | Soil | MPLVGFRLLEGRAEPASATLSPVTRDYPSRARDDLFQAAALR |
Ga0308199_10877431 | 3300031094 | Soil | MPLIGFRRREGRATPVVASLSPVARDYPSRALSDVFQATALR |
Ga0308184_10187341 | 3300031095 | Soil | MPLVGFRRLEGRVAPAATILSPVARDFPSRARSDVFQAAALR |
Ga0308191_10292031 | 3300031098 | Soil | MPLVGFRLREGAAEPASADHSPVTRDYPSRARVDHFRPPRC |
Ga0308187_102540382 | 3300031114 | Soil | MPLVGFRRQEGRAAPAAADLSPVARDYPSRALSDVFQAAALR |
Ga0308194_101375571 | 3300031421 | Soil | MPLVGFRLLEGRAEPASATLSPVTRDYPSSARDDLFQAAALR |
Ga0308186_10179461 | 3300031422 | Soil | MPLVGLRRLEGRAAPAAANLSPVARDYPSRARSDVFQAAALRLF |
Ga0308179_10146551 | 3300031424 | Soil | MPLVSFRCQEGRTTPVVATLSPVARDYPSRALSDVFQAAALRL |
Ga0308179_10254641 | 3300031424 | Soil | MPLVGFRLLEGRAEPASAHLSPVTRDYPSRARVDLFQAAALRL |
Ga0314823_1071641 | 3300031487 | Soil | MPLVGFRRQEGRAAPAATNLSPVARDYPSRALSDVFQAAALRL |
Ga0314826_1141912 | 3300031493 | Soil | MPRFGSRQQEGKAAPVAANLSPVARDYPSRARVDSFQAAALR |
Ga0314826_1280151 | 3300031493 | Soil | MPPVGFRFLEGRAEPVSANHCPVARDYPSRALSDVFQAAALR |
Ga0315276_110995571 | 3300032177 | Sediment | MPFVGLRRLEGRATPAVAIHSPVTRDYPSRALSGVFQAAALRLFYQGTNGR |
Ga0316588_10855351 | 3300033528 | Rhizosphere | MRAEGMTAPAVATHSPVTRDYPTRALNGPFQVVALRLFY |
Ga0335010_0136906_778_954 | 3300034092 | Freshwater | MPFNRFRDLEGRAAPAAASLSPVARDYPSRALSDFFQAAALRLFYQGTGMTVRSRSRK |
Ga0326787_069955_2_130 | 3300034363 | Soil | MPLDRYRDLEGRAAPAATNHSPVTRDYPSRARVDLFQAAALRL |
Ga0370544_09762_1_135 | 3300034447 | Soil | MPLGGFRRQEGRATPAVAYLSPVARDYPSRALNDVFQAAALRLFY |
Ga0370540_04298_2_133 | 3300034448 | Soil | MPLNWLSPLEGRATPVVASLSPVARDYPSRALSDVFQAAALRLF |
Ga0314785_002007_3_125 | 3300034479 | Soil | MPLVGFRRQEGKAAPAAAYLSPVARDYPSRALSDVFQAAAL |
Ga0314789_008281_1_132 | 3300034480 | Soil | MPLVGFRRLEGMAAPAATNLSPVARDYPSRALSDVFQAAALRLF |
Ga0314789_019542_477_608 | 3300034480 | Soil | MPLIGFRRREGRATPVVASLSPVARDYPSRALSDVFQAAALSTV |
Ga0314789_021799_461_586 | 3300034480 | Soil | MPLVGFRLLEGRAEPASANHSPVTRDYPSRARVDLFQAAALR |
Ga0370548_117672_3_116 | 3300034644 | Soil | MPVEPLARLKGRAAPAATNLSPVTRDYPSRALSGVFLA |
Ga0316599_088355_2_127 | 3300034653 | Untreated Peat Soil | MPFDGLRRQEGRTTPAVAIHSPVTRDYPSRALSDVFQAAALR |
Ga0314780_052749_2_133 | 3300034659 | Soil | MPVNPLARLKGRMAPAATNLSPVTRDYPSRALRGVFQAPALRLF |
Ga0314780_113230_3_131 | 3300034659 | Soil | MPIEPLARLKGRVAPAATNLSPVARDYPSRALSGVFQAPALRL |
Ga0314780_219090_371_505 | 3300034659 | Soil | MPRVSFRLLEGWAEPASANHSPVTRDYPSRARVDLFQAAALRLFY |
Ga0314782_136315_479_589 | 3300034661 | Soil | MPLDDFRRQEGRVAPTATSLSPVTREYPNRALGYHFR |
Ga0314783_049721_650_784 | 3300034662 | Soil | MPFDPLARLKGRVAPAATNLSPVARDYPSRALSGVFQAPALRLLR |
Ga0314786_083581_2_133 | 3300034664 | Soil | MPFKPLTRLKGRVAPAATNLSPVARDYPSRALSGVFQAPALRLF |
Ga0314786_111678_2_133 | 3300034664 | Soil | MPRVGFRRLEGMATPVVASLSPVARDYPSRALSDVFQADARSTV |
Ga0314786_127579_2_133 | 3300034664 | Soil | MPFTPLARLKGRAAPAATHLSPVARDYPSRAFRGVFQTPALRLF |
Ga0314786_172730_1_132 | 3300034664 | Soil | MPLVSFRLLEGRAEPASAHHSPVTREYPSRALSGVFQAAALRLF |
Ga0314788_073746_609_722 | 3300034666 | Soil | MPLIGFRRREGRATPVVASLSPVARDYPSRALSDDFQA |
Ga0314788_077008_2_130 | 3300034666 | Soil | MPLDDFRRQEGRVAPAATSLSPVTRDYPSRALSNVFQTAALRL |
Ga0314792_137112_2_136 | 3300034667 | Soil | MIYASLSFRLREGTVTPVVAALSPVARDYPSRALSDVFQAAALRL |
Ga0314793_059808_587_718 | 3300034668 | Soil | MPLTWLSPLEGTATPVVAYLSPVARDYPSRAINDVFQAAAHSTV |
Ga0314797_095759_2_133 | 3300034672 | Soil | MPIEPLARLKGRVAPAATNLSPVARDYPSRALSGVFQAAALRLF |
Ga0314797_136213_3_107 | 3300034672 | Soil | MPLIGFRRREGRATPVVASLSPVARDYPSRALSDV |
Ga0314798_113416_3_116 | 3300034673 | Soil | MPLVGFRRQEGRAAPAATTLSPVARDYPSRALSDVFQA |
Ga0314801_134726_454_585 | 3300034676 | Soil | MPLVGFRRLEGTAAPAATTLSPVARDYPSRALSVVFQAAALRLF |
Ga0370541_030783_1_111 | 3300034680 | Soil | MPLIGFRRREGRATPVVATLSPVAREYPSRALSDVFQ |
Ga0370546_087320_1_129 | 3300034681 | Soil | MPLVGFRRLEGRAAPAAANLSPVARDYPSRARSDVFQAAALRL |
⦗Top⦘ |